KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1353Help
Entry
NMB1353           CDS       T00027                                 

Definition
(RefSeq) aldehyde dehydrogenase
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00250  Alanine, aspartate and glutamate metabolism
nme00650  Butanoate metabolism
nme00760  Nicotinate and nicotinamide metabolism
nme01100  Metabolic pathways
nme01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NMB1353
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMB1353
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NMB1353
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     NMB1353
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     NMB1353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh PSD4
Motif
Other DBs
NCBI-GeneID: 903775
NCBI-ProteinID: NP_274371
UniProt: Q9JZ02
Position
complement(1375792..1377135)
Genome map
AA seq 447 aa AA seqDB search
MFHSVNVFTGETLYRRPAQDYAEFERRLADLKMRGGAFAQLGVTERAARLQKFADRLEAE
KERFAEMVCEEVGRCLHECRAEIGKSIELIRYYARLAPELLAHKTIATQASLSQVRFEPL
GVVFAVMPWNYPVWQVLRFAVPAMCAGNACAVKPAPSVARVSQALFDLASDGIPLAGVWL
DEAGTLKAVEDTDAMAFTGSTHTGRILAAHAGANLKKTVLELGGSNAFIVMPDADLERAA
AEACYSRFRDAGQSCNAAKRIIVTEAAADRFITLFLAECAKLKMGDPKHPDTTLAPLHRE
DLRDRVHGQVEDAVSNGAVCLTGGKIPQGRGWFYPATVLDRVNPACRVWREEVFGPAALI
LRAENEEHAIALANDSPFGLGACIYTADTERAWRFAEKIQAGSVFINRHTSSDLRLPFGG
VKDSGYGRELSEFGLYEFVNVKTYWQK
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgtttcacagtgtcaatgtatttacgggcgaaacgctttaccgccgccccgctcaagat
tatgcggagtttgaacggcggctggcggatttgaaaatgcgcggcggggcgttcgcgcaa
ctgggcgtaaccgaacgtgccgcgcgcctgcaaaaatttgccgaccgtttggaggcggag
aaagagcgttttgcggaaatggtgtgtgaggaagtcggacgctgcttgcacgaatgccgt
gcggaaatcggcaagtctatcgaactgatacgctattacgcccgccttgcccccgaactg
cttgcccacaaaaccatcgcgacgcaggcgagtttgagtcaggtgcgcttcgagcctttg
ggcgtggtgtttgccgtcatgccttggaactatcccgtctggcaggtattgcgtttcgcc
gttcccgctatgtgcgcgggcaacgcgtgcgccgtcaaacccgcgcccagcgtggcacgc
gtcagtcaggcactgttcgatttggcttcagacggcattcctctggcaggcgtgtggctg
gatgaggcgggcacgctcaaggcggttgaagataccgatgcaatggcgtttaccggttca
acgcatacggggcgcatccttgcggcacacgcgggcgcaaaccttaagaaaaccgtgttg
gagctcggcggtagcaacgcctttatcgtgatgcccgatgctgatttggagcgtgccgcc
gcagaagcctgttattcccgtttccgcgatgcggggcaatcgtgtaacgccgccaagcgc
atcatcgtaaccgaagccgcagccgatcgttttatcacgctgtttcttgccgaatgcgct
aaattgaaaatgggcgaccccaaacatcccgatactacgcttgcaccgctgcaccgcgaa
gatttgcgggacagggttcacgggcaggttgaagatgccgtttcaaacggcgcggtatgc
ctgaccggcggaaaaatcccacaagggcgaggctggttttatcccgcgacggttttagac
agggtaaatcctgcctgccgcgtctggagagaagaagtattcgggccggccgccctgatt
ttgcgcgccgaaaacgaagaacatgccatcgcccttgccaatgattccccgttcgggctc
ggtgcctgcatttataccgccgataccgaacgcgcttggcggtttgccgaaaaaatacag
gcgggatcggtgtttatcaaccgccataccagcagcgatttgcgcctgcctttcggcgga
gtcaaagattccggttacgggcgcgaattgtccgaattcgggctgtacgagttcgtcaac
gtcaaaacctactggcagaaatga

DBGET integrated database retrieval system