KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1364Help
Entry
NMB1364           CDS       T00027                                 

Definition
(RefSeq) NH(3)-dependent NAD synthetase
  KO
K01916  NAD+ synthase [EC:6.3.1.5]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00760  Nicotinate and nicotinamide metabolism
nme01100  Metabolic pathways
Module
nme_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NMB1364
Enzymes [BR:nme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.5  NAD+ synthase
     NMB1364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_synthase QueC tRNA_Me_trans Asn_synthase ThiI
Motif
Other DBs
NCBI-GeneID: 903786
NCBI-ProteinID: NP_274382
UniProt: Q9JYZ1
Position
1388857..1389678
Genome map
AA seq 273 aa AA seqDB search
MMRIFSTGGKMDTQAVITHIARWLDEYAARANAKGFVVGVSGGIDSAVVSALAARTGRPT
LLLDMPIRQHPGQLERARLHIRNLQRQYANVSAQTVDLTDTFQTFEQTVGAHQTAFDSQP
LSLANARSRLRMLTLYYYGQIHGLLVTGTGNKIEDFGVGFFTKYGDGGVDISPIADLTKT
QVYRLAEALGVDEAIQKAPPTDGLWDTERTDEEQMGASYPELEWAMGVYGTRKPEDFEGR
QREVLEIYTRLHRAMQHKINPIPVCRIPPELLG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggatattttcgacaggaggaaaaatggatacgcaggcagttatcacacatatc
gcccgatggttggacgaatacgccgcccgggcaaatgcaaaagggtttgtcgtgggcgtt
tccggcggcatcgattccgccgtcgtctccgcactcgccgcccgcaccggccgccccacg
ctgcttctggatatgccgatacgccaacaccccggccagcttgagcgggcaaggctgcac
atccgcaatctgcaacggcaatatgccaatgtaagcgcgcaaacggtcgatctgaccgac
accttccagacctttgaacaaaccgtcggtgctcatcagacggcatttgacagtcagccg
ctttccctcgccaacgccagaagccgcctacgtatgctgaccctgtactactacgggcag
atacacggactgctggttacggggacaggtaataagattgaagatttcggcgtgggcttt
tttactaaatacggcgacggcggcgtggacatcagcccgattgccgacctgaccaaaacg
caggtttaccggcttgccgaagcattgggcgtggacgaggcgattcaaaaagccccgccg
accgacggcctgtgggatacggaacgcaccgacgaagaacagatgggcgcaagctatccc
gaactggagtgggcaatgggcgtgtacggcacgcgcaaacccgaagattttgaagggcgg
cagcgcgaagttctagaaatctatacgcgacttcaccgcgccatgcagcacaaaatcaac
ccgattcccgtatgccgcattccgcccgaattgctgggctga

DBGET integrated database retrieval system