KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1371Help
Entry
NMB1371           CDS       T00027                                 

Gene name
argD
Definition
(RefSeq) acetylornithine aminotransferase
  KO
K00821  acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00220  Arginine biosynthesis
nme00300  Lysine biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01210  2-Oxocarboxylic acid metabolism
nme01230  Biosynthesis of amino acids
Module
nme_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
nme_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    NMB1371 (argD)
   00220 Arginine biosynthesis
    NMB1371 (argD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nme01007]
    NMB1371 (argD)
Enzymes [BR:nme01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.11  acetylornithine transaminase
     NMB1371 (argD)
    2.6.1.17  succinyldiaminopimelate transaminase
     NMB1371 (argD)
Amino acid related enzymes [BR:nme01007]
 Aminotransferase (transaminase)
  Class III
   NMB1371 (argD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-GeneID: 903793
NCBI-ProteinID: NP_274389
UniProt: Q9JYY4
Position
1395599..1396795
Genome map
AA seq 398 aa AA seqDB search
MQNYLTPNFAFAPMIPERASGSRVWDTKGREYIDFSGGIAVNALGHCHPALVDALNAQMH
KLWHISNIYTTRPAQELAQKLVANSFADKVFFCNSGSEANEAALKLARKYARDRFGGGKS
EIVACINSFHGRTLFTVSVGGQPKYSKDYAPLPQGITHVPFNDIAALEAAVGEQTCAVII
EPIQGESGILPATAEYLQTARRLCDRHNALLILDEVQTGMGHTGRLFAYEHYGIVPDILS
SAKALGCGFPIGAMLATEKIAAAFQPGTHGSTFGGNPMACAVGSRAFDIINTPETLNHVR
EQGQKLQTALLDLCRKTGLFSQVRGMGLLLGCVLDEAYRGRASEITAAALKHGVMILVAG
ADVLRFAPSLLLNDEDMAEGLRRLEHALTEFAATSDNP
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaactatctgacccccaatttcgcctttgccccgatgattcccgaacgcgcttca
ggcagccgcgtttgggatacgaaagggcgtgaatatattgatttttcaggcggtatcgcc
gtcaatgcgctgggacactgccaccctgcccttgtcgatgctttaaacgcgcagatgcac
aagctgtggcacatttccaatatctatacgacgcgtccagcgcaggaattggcgcaaaaa
ttggttgcaaacagttttgccgacaaggtttttttctgcaactcgggctcggaagcgaat
gaggcggcgttgaagctggcgaggaaatacgcccgcgaccgtttcggcggaggaaaaagc
gaaatcgtcgcctgtatcaacagttttcacggacgcacgctgtttaccgtgtccgtcggc
ggtcagccgaaatacagcaaggattatgcacccctgccgcaaggcattacgcacgttccg
ttcaacgatattgccgcgctggaagctgccgtcggcgaacagacctgcgcggtcatcatc
gagccgatacagggcgaaagcggcatcctgcccgccactgcggaatatttgcaaaccgcg
cgccgtctgtgcgaccggcacaatgcgttgttgattttggacgaagttcaaaccgggatg
gggcatacgggcaggctgtttgcctatgaacattacggcattgttcccgatattttgagt
tcggcaaaagccttgggctgcggctttccgatcggcgcgatgctggcgacagaaaagatt
gccgccgccttccaaccgggcacgcacggctcgactttcggcggcaacccgatggcgtgt
gcggtcggcagccgcgcattcgacatcatcaatacgcccgaaactttaaaccatgtccgt
gaacaggggcagaaacttcagacggcattgctggatttgtgcaggaaaacgggcttgttc
tcacaagttcgcgggatggggctgctactcggctgcgtgttggacgaagcctatcgcgga
cgcgcatccgaaatcaccgccgccgccttgaaacacggcgtgatgattttggttgcgggt
gcggacgtattgcgtttcgcgccttcgctactgttgaacgatgaggatatggcggaaggt
ttgcgacgtttggaacacgcgctgacggaatttgccgcgacatcagacaatccgtaa

DBGET integrated database retrieval system