KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1377Help
Entry
NMB1377           CDS       T00027                                 

Gene name
lldD
Definition
(RefSeq) L-lactate dehydrogenase
  KO
K00101  L-lactate dehydrogenase (cytochrome) [EC:1.1.2.3]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00620  Pyruvate metabolism
nme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NMB1377 (lldD)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.2  With a cytochrome as acceptor
    1.1.2.3  L-lactate dehydrogenase (cytochrome)
     NMB1377 (lldD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMN_dh NMO IMPDH Glu_synthase His_biosynth IGPS
Motif
Other DBs
NCBI-GeneID: 903799
NCBI-ProteinID: NP_274393
UniProt: Q7DDC4
Position
complement(1404902..1406074)
Genome map
AA seq 390 aa AA seqDB search
MKRDLSKMTCIEDLRRVAKRKMPRMFYDYIDSGSWTETTYRENTSDFKDIRFRQKVLVNM
EGRSLETKMIGQDVKMPVAIAPTGFTGMAHADGEILAARAAEKFGIPFTLSTMSICSIED
VAENTSAPFWFQLYVMRDREFMENLIKRAKDAKCSALVLTADLQVLGQRHKDIKNGLSAP
PKPTIANLINLATKPEWCMKMLNTERRTFRNIVGHAKNVGDLSSLSSWTSEQFDPRLSWD
DVARIKDLWGGKLIIKGIMEPEDAEKAAKSGADALIVSNHGGRQLDDTVSAIKALPDIVS
AVGSDIEVWMDSGIRSGQDILKAWALGAKGTMIGRAFLYGLGAYGEEGVTRALEILYKEM
DISMAFTGHRDIQDVDASILRGKDWGRETV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgatttgagcaaaatgacctgcatcgaagacttgcgccgcgttgccaagcgc
aaaatgccgcgtatgttttacgattacatcgattcgggttcgtggacagaaactacctac
cgtgaaaacacttcggatttcaaagacatccgcttccgtcaaaaagtattggtcaatatg
gaaggccgaagcctggaaaccaaaatgatcgggcaggatgtgaaaatgccggtggcgatt
gcgccgacgggtttcacgggtatggcacacgccgacggtgaaattttggcggcgcgggcg
gcggagaagttcggcattccgtttacgctgtccacgatgtctatctgctcgattgaagac
gttgccgagaacacttccgcaccattttggtttcagctttatgtgatgcgcgaccgcgag
tttatggaaaacctgattaagcgcgcgaaggatgccaaatgttcggcattggtattgacc
gctgatttgcaggttttggggcaacgccacaaagacatcaaaaacggcctgtccgcgccg
ccgaaaccgaccatcgccaatttaatcaatctggcgaccaagcccgaatggtgtatgaaa
atgctgaacacggaacgccgcacgttccgcaatatcgtcggacacgcgaagaacgtcggc
gatttgtcttcgctgtcttcatggacttccgaacaattcgacccgcgcctgagctgggac
gatgtggcgcgcattaaagatttgtggggcggcaagctgattatcaaaggcattatggaa
cctgaagacgcggaaaaagcagcgaaaagcggcgcggacgcattgattgtttccaaccac
ggcggtcgacagctcgacgataccgtgtctgccatcaaagccttgcccgacatcgtcagc
gcagtgggcagcgacatcgaagtttggatggacagcggcatccgcagcggtcaggatatt
ttgaaggcgtgggctttgggcgcgaaaggtacaatgataggtcgggcgttcctgtatggc
ttgggcgcgtatggagaagaaggcgtaacccgtgcgctggaaatcctgtataaagaaatg
gatatatctatggcgtttacgggacaccgcgatattcaagatgtcgatgcttcgattttg
agaggcaaagattggggcagggaaacggtttag

DBGET integrated database retrieval system