KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1388Help
Entry
NMB1388           CDS       T00027                                 

Gene name
pgi
Definition
(RefSeq) glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00010  Glycolysis / Gluconeogenesis
nme00030  Pentose phosphate pathway
nme00500  Starch and sucrose metabolism
nme00520  Amino sugar and nucleotide sugar metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
Module
nme_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMB1388 (pgi)
   00030 Pentose phosphate pathway
    NMB1388 (pgi)
   00500 Starch and sucrose metabolism
    NMB1388 (pgi)
   00520 Amino sugar and nucleotide sugar metabolism
    NMB1388 (pgi)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nme04147]
    NMB1388 (pgi)
Enzymes [BR:nme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     NMB1388 (pgi)
Exosome [BR:nme04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NMB1388 (pgi)
  Exosomal proteins of other body fluids (saliva and urine)
   NMB1388 (pgi)
  Exosomal proteins of colorectal cancer cells
   NMB1388 (pgi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGI DUF4473
Motif
Other DBs
NCBI-GeneID: 903810
NCBI-ProteinID: NP_274402
UniProt: Q9JYX3
Position
complement(1414892..1416538)
Genome map
AA seq 548 aa AA seqDB search
MKHLHDLPAWSKLWNHFDDSKTLHMREMFEQDPQRAERYWLQVGGLTLDYSKNRINDETM
SLLFELAREAGVPERMRQMFHGEKINTTENRAVLHVALRNRTNSPIVVDGEDVMPKVNRV
LQRMGEFAHEVRSGSWLGYTNQVITDVVNIGIGGSDLGPLMMCTALKPFGHPRLNMHFVS
NVDGSQLRDVLSKVHPETTLFIIASKTFTTQETLTNALTAREWFLNHAGDEEAVAKHFAA
VSTNQKAVAEFGIDTANMFEFWDWVGGRYSLWSAIGLPIMLYLGEENFIEMLNGAHLMDQ
HFINTPLERNLPVILALIGIWYINYYGGGSHVIAPYDQHLHRLPKFIQQLDMESNGKQVT
LDGKAVGHETSPIIWGETGINGQHAFFQLLHQGTHITPIDLIASLEKRSNLPGHHEILLA
NVFAQAEAFMRGKTPDEVRAELKAQGMDEVRIEELVPHKTFSGNRPTNLILMDKVNPRNM
GSLIAMYEHKTFVQGIIWGINSFDQWGVELGKQLAKTILGELTGETGPQKHDSSTERLIN
LYLQTNRK
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaccttcacgacttacccgcatggtcgaaattgtggaatcactttgacgacagc
aaaacattgcatatgcgcgaaatgttcgagcaagacccgcagcgtgcggaacgctactgg
ctgcaagtcggcggactgacgctggactactccaaaaaccgcatcaacgacgaaaccatg
tcgcttttgttcgagcttgcccgagaagcaggcgtgccggagcggatgcggcagatgttc
cacggcgaaaaaatcaataccaccgaaaaccgcgccgtcctgcatgtcgcccttcgcaac
cgcaccaattcgccgattgtggttgacggtgaagatgtgatgcccaaagtcaaccgcgtt
ttgcaacgtatgggcgaatttgcacacgaagtccgcagcggaagctggctgggctatacc
aaccaagtcattaccgacgttgtcaacatcggcatcggcggatcggatttgggtccgctg
atgatgtgtaccgcgctcaaacctttcggtcatccgcgcctcaatatgcacttcgtctcc
aacgtggacggctcgcaactgcgcgacgtattgtccaaagtccaccccgaaaccacgttg
ttcatcatcgcctccaaaacatttaccacgcaggaaacgctgaccaacgcgctgaccgcg
cgcgaatggtttttgaatcatgcgggcgacgaagaagccgttgccaaacacttcgccgcc
gtttccaccaatcaaaaagccgtcgccgaattcggcatcgacaccgccaatatgtttgaa
ttttgggattgggtcggcggtcggtacagcctgtggtccgccatcggattgccgattatg
ctgtatctcggcgaagaaaacttcattgaaatgctcaacggcgcgcacctgatggaccaa
cacttcatcaacacaccgctcgagcgcaacctgcccgtcattctcgccctcatcggcatc
tggtatatcaactactacggcggcggcagccacgtcatcgcgccttacgaccaacatttg
caccgcctgcccaaattcatccagcagctcgatatggaaagtaacggcaaacaggttacg
ttggacggcaaagcagtcggacacgaaacctcgccgattatctggggcgaaacgggcatt
aacggccagcacgcctttttccaactgctgcaccaaggcacgcacattacccccatcgac
ctgattgcctcgcttgaaaaacgcagcaacctgcccggacaccacgaaatcctgcttgcc
aacgtcttcgcccaagcagaagcctttatgcgcggcaaaacccccgacgaagtccgcgcc
gaactcaaagcgcagggtatggatgaggtgcgcatcgaagagctggtcccgcacaaaacc
ttctccggcaaccgcccgaccaacctcattctcatggacaaggtcaacccgcgcaatatg
ggcagcctgattgccatgtacgaacacaaaaccttcgtacaaggcatcatttggggcatc
aacagcttcgaccagtggggcgtggaactcggcaaacaactggctaaaaccattttgggc
gaactgaccggcgaaaccgggccgcaaaagcacgacagttcgaccgaacgcctgatcaac
ctctacctgcagaccaaccgcaaataa

DBGET integrated database retrieval system