KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1390Help
Entry
NMB1390           CDS       T00027                                 

Gene name
glk
Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00010  Glycolysis / Gluconeogenesis
nme00052  Galactose metabolism
nme00500  Starch and sucrose metabolism
nme00520  Amino sugar and nucleotide sugar metabolism
nme00521  Streptomycin biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
Module
nme_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMB1390 (glk)
   00052 Galactose metabolism
    NMB1390 (glk)
   00500 Starch and sucrose metabolism
    NMB1390 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    NMB1390 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NMB1390 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    NMB1390 (glk)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     NMB1390 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-GeneID: 903812
NCBI-ProteinID: NP_274404
UniProt: P64254
Position
complement(1417557..1418543)
Genome map
AA seq 328 aa AA seqDB search
MSSTPNKQAGYPRLVADIGGTNARFALETAPRVIEKAAVLPCKDYDTVTDAVRAYLNQSG
ATAVRHAAFAIANPILGDWVQMTNHHWAFSIETTRQTLGLDTLILLNDFTAQALAVTQTS
SKDLMQVGGQKPVEFAPKAVIGPGTGLGVSGLVHSHAGWVALAGEGGHTSFPPFDDMEVL
IWQYAKNKYGHVSAERFLSGAGLSLVYEALAAKQKAKPAKLMPSEITEKALSGASPLCRQ
TLDIFCAMLGTVASNLALTLGARGGVYLCGGIIPRVLEYFKTSPFRSRFENKGRFEAYLA
AIPVYVVLSEFPGISGAAAALDNHLRNV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctacgccgaataaacaagccggatatccccgactggtcgccgatatcggcggg
acgaatgcacgctttgcgctggaaaccgcgccgcgcgtcattgaaaaagccgccgtgctt
ccgtgtaaagactacgatacggttaccgatgcggtgcgtgcctatctgaatcaaagcggt
gcaacagccgtacggcacgcggcatttgccatcgccaacccgattttgggcgactgggtg
cagatgaccaaccaccattgggcgttttccatcgaaaccacccgtcagactttggggctg
gacaccctcatccttttgaacgactttaccgcgcaggcattggcggtaacgcagacttca
agcaaagacctgatgcaggtaggcgggcaaaagcctgtcgaatttgcccccaaagccgtt
atcggccccggtaccggcctgggcgtgagcggattggtgcacagccacgcaggctgggtg
gctttggcgggcgagggcgggcataccagtttcccgccgtttgacgatatggaagtgctg
atttggcagtacgccaaaaacaaatacggccatgtttccgccgaacgctttttgagcggc
gcgggcttgagcttggtttacgaggctttggctgcaaaacagaaagccaaacccgccaaa
ctgatgccgtctgaaatcacggaaaaggctttgagcggcgcgtcgcctttgtgccgtcag
actttggacatcttctgcgccatgctcggcacggttgcttccaacctcgccctgacgctg
ggcgcgcgcggcggcgtgtacctgtgtggcggcattattccccgcgtgttggaatatttc
aaaacttccccgttccgcagccgtttcgagaacaagggcaggtttgaagcatatcttgcc
gcgattcccgtgtatgtcgtcttgagcgagtttcccggaatttccggtgcggctgcggct
cttgacaaccatttgagaaacgtttaa

DBGET integrated database retrieval system