KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1393Help
Entry
NMB1393           CDS       T00027                                 

Gene name
edd
Definition
(RefSeq) phosphogluconate dehydratase
  KO
K01690  phosphogluconate dehydratase [EC:4.2.1.12]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00030  Pentose phosphate pathway
nme01100  Metabolic pathways
nme01120  Microbial metabolism in diverse environments
nme01200  Carbon metabolism
Module
nme_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NMB1393 (edd)
Enzymes [BR:nme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.12  phosphogluconate dehydratase
     NMB1393 (edd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD BOF
Motif
Other DBs
NCBI-GeneID: 903815
NCBI-ProteinID: NP_274407
UniProt: Q9JYX1
Position
1421512..1423347
Genome map
AA seq 611 aa AA seqDB search
MNTTPIHSKLAEITGRIIERSRPTREKYLAKIRSAKQMGRLERNQLGCSNLAHGYAAMPK
SIKIEMLQETVPNLGIITAYNDMVSAHQPFKDFPDQIKDEAQKNGATAQVAGGTPAMCDG
ITQGYAGMELSLFSRDVIAMSTAIGLSHQMFDGSLFMGVCDKIVPGLMIGALSFGHIPGI
FVPAGPMSSGIGNKEKARTRQLFAEGKVGRNELLKSEMGSYHSPGTCTFYGTANSNQMMM
EMMGVHLPAAAFVHPYTDLREALTRYAAGHLARGIKNGTIKPLGEMLTEKSFINALIGLM
ATGGSTNHTMHLVAMARAAGVILNWDDFDEISSIIPLLIRVYPNGKADVNHFTAAGGLPF
VIRELLNAGLLHDDVDTVVGHGMRHYTKEPFLIDGKLEWREAPETSGNDDILRKADNPFS
PDGGLRLMKGNIGRGVIKVSAVREGCRIIEAPAIVFNDQREVLAAFERGELERDFVCVVR
YQGPRANGMPELHKLTPPLGILQDRGFKVALLTDGRMSGASGKVPASIHMTPEALMGGNI
AKIRTGDLIRFDSVSGELNVLINETEWNAREVESIDLGANQQGCGRELFANFRSMTSSAE
TGAMSFGGEFA
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
gtgaacactactcctatccactccaaactcgccgaaatcaccgggcgcattattgaacgc
agccgtccgacgcgtgaaaaatatctggcgaagatccgcagtgccaaacaaatgggacgc
ttagagcgcaaccagctcggctgcagcaacttggcacacggctatgctgccatgcctaaa
agtatcaaaatcgaaatgcttcaggaaaccgtccccaacttaggcatcatcaccgcctac
aacgacatggtttccgcacaccagccgtttaaagacttccctgaccaaatcaaagacgaa
gcgcagaaaaacggcgcgaccgcccaagtcgccggcggcacgcccgccatgtgcgacggc
atcacgcaaggctacgccggcatggaattgtcgctgttctcccgcgacgtgattgccatg
agtaccgccatcgggctgtcgcatcaaatgtttgacggcagcctgtttatgggcgtatgc
gacaaaatcgttccaggtttgatgataggcgcgctttcgttcggtcatattccgggtatc
ttcgtccccgcaggcccgatgtccagcggtatcggcaacaaagaaaaagcccgcacccgc
cagcttttcgccgaaggcaaggtcggacgcaacgaacttttgaaaagcgaaatgggttct
taccacagcccgggcacctgcactttctacggcacggcaaactccaaccaaatgatgatg
gaaatgatgggcgtgcacctgcctgccgccgccttcgtccacccttacaccgacctgcgc
gaagcgctgacccgctacgccgccggacacctcgcgcgcggcatcaaaaacggcacgatt
aaacctttgggcgaaatgttgaccgaaaaatcctttatcaacgccttgattggcctgatg
gcaaccggcggttcgaccaaccacaccatgcacctcgtcgctatggcgcgtgcggccggc
gtgattttgaactgggacgacttcgacgaaatttcctccatcatcccgctgctcatccgc
gtttatccgaacggcaaggccgacgtgaatcactttaccgcagcgggcggactgcctttc
gttatccgcgaattgctgaatgcaggcctgttgcacgacgatgtcgataccgtcgtcgga
cacggtatgcgccactacaccaaagagcctttccttatcgacggcaaactcgaatggcgc
gaagcccccgaaaccagcggcaacgacgacatcctgcgcaaagctgacaacccgttctcc
cccgacggcggtctgcgcctgatgaaaggcaacatcggacgcggcgtgattaaagtgtcc
gccgtgcgcgaaggctgccgcattattgaagcgcctgccatcgtgttcaacgaccaacgc
gaagtgttggctgcgtttgaacgcggcgagttggaacgcgattttgtgtgcgtcgtccgc
taccaaggcccgcgtgccaacggtatgcccgaattgcacaaactgaccccgcctttgggc
atcctgcaagaccgcggcttcaaagtggcgctgctgaccgacggccgtatgtccggcgcg
tccggcaaagttccagcctccatccacatgacacccgaagccctgatgggcggcaacatc
gccaaaatccgtaccggcgacctgatccgcttcgactccgttagcggcgaactcaacgtc
ctgattaacgaaaccgaatggaatgcccgcgaagtcgaaagcatcgacttgggcgcgaac
caacaaggctgcggccgcgaactcttcgccaacttccgcagcatgaccagcagcgcggaa
accggtgccatgagtttcggcggcgaatttgcctga

DBGET integrated database retrieval system