KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1394Help
Entry
NMB1394           CDS       T00027                                 

Gene name
eda
Definition
(RefSeq) keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
  KO
K01625  2-dehydro-3-deoxyphosphogluconate aldolase / (4S)-4-hydroxy-2-oxoglutarate aldolase [EC:4.1.2.14 4.1.3.42]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00030  Pentose phosphate pathway
nme00630  Glyoxylate and dicarboxylate metabolism
nme01100  Metabolic pathways
nme01120  Microbial metabolism in diverse environments
nme01200  Carbon metabolism
Module
nme_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NMB1394 (eda)
   00630 Glyoxylate and dicarboxylate metabolism
    NMB1394 (eda)
Enzymes [BR:nme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.14  2-dehydro-3-deoxy-phosphogluconate aldolase
     NMB1394 (eda)
   4.1.3  Oxo-acid-lyases
    4.1.3.42  (4S)-4-hydroxy-2-oxoglutarate aldolase
     NMB1394 (eda)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase
Motif
Other DBs
NCBI-GeneID: 903816
NCBI-ProteinID: NP_274408
UniProt: Q7DDC2
Position
1423528..1424166
Genome map
AA seq 212 aa AA seqDB search
MSKLTPREILTAGAVVPVMAIDDLSTAIDLSHALVEGGIPTLEITLRTPVGLDAIRLIAK
EVPNAIVGAGTVTNPEQLKAVEDAGAVFAISPGLHESLAKAGHNSGIPLIPGVATPGEIQ
LALEHGIDTLKLFPAEVVGGKAMLKALYGPYADVRFCPTGGISLATAPEYLALPNVLCVG
GSWLTPKEAVKNKDWDTITRLAKEAAALKPKA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaactgaccccccgcgaaattttgaccgccggcgcagttgtgccggtaatggcg
attgacgacttaagcaccgccatcgatttgtcccacgcccttgtcgaaggcggcatccct
accctcgaaatcaccctgcgcacccctgtcggcctcgatgccatccgcctgattgccaaa
gaagtgcccaacgccatcgtcggcgcaggtacggtaaccaatcccgaacagctcaaagcc
gtcgaagacgcaggcgcggttttcgccatcagcccggggctgcatgaatccctcgccaaa
gccggccacaacagcggcatccccctgattcccggtgttgccaccccgggcgaaatccaa
ctggctttggaacacggcatcgacaccctcaaactcttccccgccgaagtcgtcggcggc
aaagccatgctcaaagccctgtacggcccttacgccgatgttcgcttctgcccgacaggc
ggcatcagcctcgccaccgcgcccgagtacttggcactgcccaacgtcctgtgcgtcggc
ggctcttggctgacaccgaaagaagccgtgaaaaacaaagactgggacaccatcacccgc
ctcgccaaagaagcggcggcgttgaaacccaaagcctga

DBGET integrated database retrieval system