KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1429Help
Entry
NMB1429           CDS       T00027                                 

Gene name
porA
Definition
(RefSeq) outer membrane protein PorA
  KO
K18132  major outer membrane protein P.IA
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nme02000]
    NMB1429 (porA)
Transporters [BR:nme02000]
 Other Transporters
  Pores ion channels [TC:1]
   NMB1429 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Porin_1 Porin_4
Motif
Other DBs
NCBI-GeneID: 903851
NCBI-ProteinID: NP_274441
UniProt: P0DH58
Position
complement(1467069..1468247)
Genome map
AA seq 392 aa AA seqDB search
MRKKLTALVLSALPLAAVADVSLYGEIKAGVEGRNYQLQLTEAQAANGGASGQVKVTKVT
KAKSRIRTKISDFGSFIGFKGSEDLGDGLKAVWQLEQDVSVAGGGATQWGNRESFIGLAG
EFGTLRAGRVANQFDDASQAIDPWDSNNDVASQLGIFKRHDDMPVSVRYDSPEFSGFSGS
VQFVPIQNSKSAYTPAYYTKNTNNNLTLVPAVVGKPGSDVYYAGLNYKNGGFAGNYAFKY
ARHANVGRNAFELFLIGSGSDQAKGTDPLKNHQVHRLTGGYEEGGLNLALAAQLDLSENG
DKTKNSTTEIAATASYRFGNAVPRISYAHGFDFIERGKKGENTSYDQIIAGVDYDFSKRT
SAIVSGAWLKRNTGIGNYTQINAASVGLRHKF
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaaaacttaccgccctcgtattgtccgcactgccgcttgcggccgttgccgat
gtcagcctatacggcgaaatcaaagccggcgtggaaggcaggaactaccagctgcaattg
actgaagcacaagccgctaacggtggagcgagcggtcaggtaaaagttactaaagttact
aaggccaaaagccgcatcaggacgaaaatcagtgatttcggctcgtttatcggctttaag
gggagtgaggatttgggcgacgggctgaaggctgtttggcagcttgagcaagacgtatcc
gttgccggcggcggcgcgacccagtggggcaacagggaatcctttatcggcttggcaggc
gaattcggtacgctgcgcgccggtcgcgttgcgaatcagtttgacgatgccagccaagcc
attgatccttgggacagcaataatgatgtggcttcgcaattgggtattttcaaacgccac
gacgacatgccggtttccgtacgctacgattcccccgaattttccggtttcagcggcagc
gttcaattcgttccgatccaaaacagcaagtccgcctatacgccggcttattatactaag
aatacaaacaataatcttactctcgttccggctgttgtcggcaagcccggatcggatgtg
tattatgccggtctgaattacaaaaatggcggttttgccgggaactatgcctttaaatat
gcgagacacgccaatgtcggacgtaatgcttttgagttgttcttgatcggcagcgggagt
gatcaagccaaaggtaccgatcccttgaaaaaccatcaggtacaccgtctgacgggcggc
tatgaggaaggcggcttgaatctcgccttggcggctcagttggatttgtctgaaaatggc
gacaaaaccaaaaacagtacgaccgaaattgccgccactgcttcctaccgcttcggtaat
gcagttccacgcatcagctatgcccatggtttcgactttatcgaacgcggtaaaaaaggc
gaaaataccagctacgatcaaatcatcgccggcgttgattatgatttttccaaacgcact
tccgccatcgtgtctggcgcttggctgaaacgcaataccggcatcggcaactacactcaa
attaatgccgcctccgtcggtttgcgccacaaattctaa

DBGET integrated database retrieval system