KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1432Help
Entry
NMB1432           CDS       T00027                                 

Gene name
aroA
Definition
(RefSeq) 3-phosphoshikimate 1-carboxyvinyltransferase
  KO
K00800  3-phosphoshikimate 1-carboxyvinyltransferase [EC:2.5.1.19]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
nme01230  Biosynthesis of amino acids
Module
nme_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMB1432 (aroA)
Enzymes [BR:nme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.19  3-phosphoshikimate 1-carboxyvinyltransferase
     NMB1432 (aroA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-GeneID: 903854
NCBI-ProteinID: NP_274444
UniProt: Q9JYU1
Position
1471398..1472699
Genome map
AA seq 433 aa AA seqDB search
MTESVRLPVARLKPSTVALPGSKSISNRTLLLAALSDNACEIHSLLKSDDTDRMLEALDK
LGVQIEYLAEDRLKVHGTGGRFPNRTADLFLGNAGTAFRPLTAALAVLGGDYHLHGVPRM
HERPIGDLVDALRIAGADVEYLGKEHYPPLHIGERQDNGERVIPIKGNVSSQFLTALLMA
LPLTGQAFEIRMVGELISKPYIDITLKLMAQFGVQVINEGYRVFKIPADAHYHAPEHLHV
EGDASSASYFLAAGLIAATPVRVTGIGANSIQGDVAFARELEKIGADVVWGENFVEVSRP
KERAVQSFDLDANHIPDAAMTLAIVALATGQTCTLRNIGSWRVKETDRIAAMANELRKLG
AKVVEEAEAIHITPPETLTPDAVIDTYDDHRMAMCFSLVSLLGVPVVINDPKCTHKTFPT
YFDVFSSLTETAE
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaatccgtccgcctccccgtcgcccgtctcaaaccttccaccgtcgccctgccc
ggctccaaaagcatcagcaaccgcaccctgctgcttgccgccttgtccgacaatgcttgc
gaaatccattccctgctcaaatccgacgataccgaccgtatgctcgaagcactcgataaa
ctcggcgttcaaatcgaatatcttgccgaagaccgtctgaaagtgcacggcacaggcgga
cgcttccccaaccgcactgccgatttgtttttgggcaacgcgggcacggcgttccgcccg
ttaaccgccgctctggccgttttgggcggcgattatcatctgcacggcgtgcctcgtatg
cacgaacgtcctatcggcgatttggtcgatgcgttgcggattgccggggccgatgtcgaa
tatctcggcaaggaacactatccgccgcttcatatcggcgaacgccaagacaacggcgag
cgcgtgattccgattaaaggcaatgtgtccagccagtttctgaccgcccttttaatggcg
ttgccgctgaccgggcaggcgtttgaaatccgtatggtcggcgaattgatttccaagccc
tatatcgacattactttaaaactgatggcgcaattcggcgtacaggttatcaatgaaggc
taccgcgtcttcaaaattcccgccgatgcgcactaccacgcgcccgaacacttgcacgtc
gaaggcgatgcctccagcgcgtcctacttcctcgcagccggtttgattgccgccacgccc
gtccgcgttaccggtatcggcgcaaacagcatacagggcgatgtcgcctttgcccgcgag
ctggaaaaaatcggggcggacgtggtttggggcgaaaacttcgtcgaagtttcacgcccg
aaggaacgtgccgtccaatcctttgatttggatgcgaaccatatccccgatgccgccatg
accctcgccatcgtcgcgcttgctacagggcaaacctgcacgctgcgcaacatcggttcg
tggcgcgtcaaagaaaccgaccgcatcgccgcaatggcaaacgagttgcgcaaactcggg
gcaaaagtcgtcgaagaagccgaagcaattcacatcaccccgcccgaaacgctgacaccc
gacgccgtcatcgacacgtacgacgaccaccgcatggcgatgtgtttctcgctggtttcg
ctgttgggcgtacccgtcgtcatcaacgatccgaaatgcacccacaaaaccttcccgact
tatttcgacgtgttctcatcgctgaccgaaacagcggaataa

DBGET integrated database retrieval system