KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1439Help
Entry
NMB1439           CDS       T00027                                 

Gene name
purE
Definition
(RefSeq) 5-(carboxyamino)imidazole ribonucleotide mutase
  KO
K01588  5-(carboxyamino)imidazole ribonucleotide mutase [EC:5.4.99.18]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00230  Purine metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
Module
nme_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NMB1439 (purE)
Enzymes [BR:nme01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.18  5-(carboxyamino)imidazole ribonucleotide mutase
     NMB1439 (purE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRC PilX_N
Motif
Other DBs
NCBI-GeneID: 903860
NCBI-ProteinID: NP_274451
UniProt: Q9JYT5
Position
complement(1479923..1480408)
Genome map
AA seq 161 aa AA seqDB search
MIQIGIIMGSNSDWPVMRQAAQFLEEFGVEYEARVVSAHRTPDLMFQYAETARARGIKAI
IAGAGGAAHLPGMVAAKTTVPVLGVPVPSKYLRGEDSLLSIVQMPKGVPVATFAIGEAGA
ANAALFAVSMLANETPELAQKLADFRAKQEQAVLNMELEQI
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgatacaaatcggcatcatcatgggcagcaacagcgattggcccgttatgcggcaggca
gcgcagtttcttgaagagttcggcgtagaatatgaggcgcgcgttgtttccgcacaccgc
accccggatttgatgttccaatacgccgaaaccgcacgggcgcgcggcatcaaagccatc
atcgcgggtgcgggcggcgcggcgcatttacccggtatggttgccgccaagaccaccgtc
cccgttttgggcgtacccgtccccagcaaatacctgcgcggcgaagattcgcttttatcg
attgtacaaatgcccaaaggcgtacccgtcgccacattcgccatcggcgaggcaggcgcg
gcaaatgccgcattgttcgccgtttccatgctcgccaacgaaacccccgaactggcgcaa
aaactggcagacttccgagccaaacaggaacaggctgttttgaatatggaattggaacaa
atttaa

DBGET integrated database retrieval system