KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1441Help
Entry
NMB1441           CDS       T00027                                 

Definition
(RefSeq) O-methyltransferase
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_3 Methyltransf_24 Methyltransf_25 Methyltransf_31 Methyltransf_11 PCMT
Motif
Other DBs
NCBI-GeneID: 903862
NCBI-ProteinID: NP_274453
UniProt: Q9JYT3
Position
complement(1481169..1481837)
Genome map
AA seq 222 aa AA seqDB search
MTTHLSNVAPDLQNYLNAIGEPEHPVLTRLREKTGHHRMGKMAIAREQAAVLVWLAKLIR
AEKYLEIGVFTGYSSTALALALPEHGRITACDINVTFTDTARQVWNEAGVAHKISLHLQP
ALLTLDDLIAQGEAGSYDLALIDADKPPTPQYFERCLKLVRQGGIIAIDNILLNGRVMRE
AASDAPPSVGILKDFNQNLPNDPRIVPITLPVGDGLTLLLKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgacgacccatctgtccaatgtcgcaccggacctgcaaaactatttgaacgccatcggc
gaacccgaacatcccgttttgacgcggctgcgcgagaagaccgggcatcaccgtatgggc
aaaatggcgattgcgcgcgaacaggcggcagttttggtttggctggcaaagctgatccgt
gcggaaaaatatctggaaatcggcgtatttaccggatacagcagcaccgcgcttgcattg
gcactgcccgaacacgggcggattaccgcctgcgacatcaatgtaacctttaccgatacg
gcgcgtcaggtttggaacgaggccggtgtggcacataaaatcagcctgcacctgcaaccc
gcattgctgacattggatgatttgattgcacagggtgaagccggaagctacgatttggca
ctgatagacgcagacaaaccgcccacgccgcaatatttcgagcgttgcctcaaactcgtc
cgtcaaggcggcatcatcgccatcgacaatattttgctgaacggaagggtgatgcgcgaa
gcggcttccgatgcgccgcccagcgtcggcatcctcaaagatttcaatcaaaacctgccg
aacgacccgcgcatcgtccccatcaccctgcccgtcggcgacggcttgaccctgcttctg
aaaaaataa

DBGET integrated database retrieval system