KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1446Help
Entry
NMB1446           CDS       T00027                                 

Gene name
aroD
Definition
(RefSeq) 3-dehydroquinase
  KO
K03785  3-dehydroquinate dehydratase I [EC:4.2.1.10]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
nme01230  Biosynthesis of amino acids
Module
nme_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMB1446 (aroD)
Enzymes [BR:nme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.10  3-dehydroquinate dehydratase
     NMB1446 (aroD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHquinase_I
Motif
Other DBs
NCBI-GeneID: 903866
NCBI-ProteinID: NP_274458
UniProt: Q9JYT0
Position
1489848..1490612
Genome map
AA seq 254 aa AA seqDB search
MCSCLVVKNTVIGSGRTKIAVPLVARDAAELSAVLEQIKNMPFDIAEFRADFLECAGSIG
EILHHTQTVRDALPDKPLLFTFRRHGEGGSFPCSDDYYFELLDALIESRLPDIIDIELFS
GETAVRCAVANAQKNGIAALLCNHEFHRTPPQEEIVCRLKQMEDCGADICKIAVMPQSAE
DVLTLLSATLKAKELAAKPIVTMSMGQTGAVSRLAGQVFGSSITFGSGTQNSAPGQIGVS
ALRATLDCLENGAD
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcctgccttgttgtcaaaaataccgttatcggaagcggacgcaccaaaatcgcc
gtgccgcttgtcgcccgcgatgccgccgaactttccgccgtacttgagcaaatcaaaaat
atgcccttcgatattgcggagttccgcgccgactttttggaatgcgcgggcagtatcggc
gaaatattgcaccacacgcagaccgtccgcgacgcgctgcccgacaagccgctgctgttt
acgttcagacggcatggcgaaggcggctcgttcccgtgttcggacgattattattttgaa
ctgctcgacgcgctgatcgaaagccgcctgcccgacatcatcgacatcgagctgttttcc
ggcgaaaccgccgtccggtgcgccgtggcaaatgctcaaaaaaacggcatcgccgccctg
ctctgcaatcatgagtttcaccgcacgccgccgcaagaagaaatcgtatgccgtctgaaa
cagatggaggactgcggcgcggacatctgcaaaattgcggtgatgccgcaaagcgcggaa
gatgtgctgactttgctttccgccacgctcaaagcgaaagagcttgccgccaaaccgatt
gttacgatgtcgatggggcagacgggggcggtcagccggcttgccggacaggtgttcggc
tcaagcatcacgttcggttcgggaacgcaaaactccgcgccggggcaaatcggcgtatcc
gccctccgtgcgacactcgactgcctcgaaaacggcgcagactga

DBGET integrated database retrieval system