KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1476Help
Entry
NMB1476           CDS       T00027                                 

Gene name
gluD
Definition
(RefSeq) glutamate dehydrogenase
  KO
K00260  glutamate dehydrogenase [EC:1.4.1.2]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00220  Arginine biosynthesis
nme00250  Alanine, aspartate and glutamate metabolism
nme00430  Taurine and hypotaurine metabolism
nme00910  Nitrogen metabolism
nme01100  Metabolic pathways
nme01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    NMB1476 (gluD)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMB1476 (gluD)
   00220 Arginine biosynthesis
    NMB1476 (gluD)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    NMB1476 (gluD)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     NMB1476 (gluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ELFV_dehydrog ELFV_dehydrog_N 2-Hacid_dh_C Bac_GDH
Motif
Other DBs
NCBI-GeneID: 903898
NCBI-ProteinID: NP_274485
UniProt: Q9JYQ5
Position
complement(1526157..1527422)
Genome map
AA seq 421 aa AA seqDB search
MSEALAKETLNPFEIARKQVKTACDRLKTDPAVYEILKSPTRVLEVNFPVKLDDDTVKTF
TGYRSQHNNAVGPYKGGVRFHPSVNLDEVKALSIWMTIKCCVAGIPYGGGKGGITLDPRD
YSEAELERIARAYAEAIAPLIGEKIDIPAPDVNTNGKIMSWMVDAYENVVKHSAPGVFTG
KPVEFGGSLARTEATGYGVNLAAVQALEKLGKDVKGATYAIQGFGNVGYHTGYYAHQSGA
KVVAVSTVDVAIYNENGLDMEALFKEFQEKGFITNEAGYGKEITNAELLALDVDVLAPCA
LENQLTSENAGKVRAKIVVEGANGPTTPEADVILRQNGVLVVPDILANCGGVVVSYFEWV
QNLQGYYWEFDEVQEKETVVLRRAFRDIWNLAQEYDVDLRTASYMMSIRRVEKAMKLRGW
Y
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagcccttgcaaaagaaaccctcaatccgtttgaaatcgcgcgcaaacaggtg
aaaaccgcctgtgaccggctgaaaaccgatccggccgtttatgaaatcctgaagagtccg
acccgcgtgttggaagtcaattttcccgtcaaactcgacgacgacacggtcaaaaccttc
acgggctaccgttcgcaacacaacaacgccgtcggcccctataaaggcggcgtgcgcttc
catcccagtgtgaatttggacgaagtcaaagccctgtcaatttggatgaccatcaaatgc
tgcgttgcgggtattccttacggcggcggcaaaggcggcattaccttggatccgcgcgat
tattccgaggcggaactggaacgcatcgcccgcgcttatgctgaagcgattgccccgctg
attggcgagaaaatcgatattcccgcccccgatgtgaataccaacggcaaaattatgtcg
tggatggtggatgcttatgaaaacgtggtgaaacattccgcgccgggcgtatttaccgga
aaaccggttgagttcggcggctctttggcgcgtaccgaggctaccggttacggcgtgaac
ctcgccgccgtccaagctttggaaaaactgggcaaggacgtgaagggtgccacttacgcc
attcaaggtttcggtaatgtgggttaccacacaggttattacgcgcatcaatccggcgcg
aaagttgttgcggtttctactgttgacgttgccatttacaacgaaaacggtttggatatg
gaagctttgtttaaagagttccaagaaaaaggcttcatcaccaacgaagccggttacggc
aaagaaattaccaacgccgaacttttggctttggatgtggacgtactcgccccttgcgcg
ctggaaaaccaactgacttccgaaaacgccggtaaagtccgcgcgaaaatcgtagtcgaa
ggcgcgaacggcccgactacgcccgaagccgacgtgatcctgcgtcaaaacggcgtattg
gtcgtgcctgatattctggcgaactgcggcggcgtggtcgtttcctatttcgagtgggtg
caaaacctgcaaggctattattgggagtttgacgaagttcaagagaaagaaaccgtcgtc
ctgcgacgcgcgttccgcgatatatggaacttggcgcaagagtatgatgtcgatttgcga
accgcgtcttacatgatgagtatccgccgtgttgaaaaagcgatgaaactgcgcggttgg
tattga

DBGET integrated database retrieval system