KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1496Help
Entry
NMB1496           CDS       T00027                                 

Definition
(RefSeq) 23S rRNA pseudouridine synthase E
  KO
K06181  23S rRNA pseudouridine2457 synthase [EC:5.4.99.20]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:nme03009]
    NMB1496
Enzymes [BR:nme01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.20  23S rRNA pseudouridine2457 synthase
     NMB1496
Ribosome biogenesis [BR:nme03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    NMB1496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-GeneID: 903918
NCBI-ProteinID: NP_274504
UniProt: Q9JYN7
Position
1541711..1542271
Genome map
AA seq 186 aa AA seqDB search
MKNLIAFNKPYGVICQFSPHEKHKSLKDFINLPGFYPAGRLDTDSEGLLLLTDDGRLQAQ
ITDPKFKHPKTYWAQLEGVPDESRLESLRKGIDLGGFVTRPASIRILKHGEADSLWERIP
PIRVRKTVPDFWIEITISEGKNRQVRRMTAKAGYPCLRLIRVASGRLKLFDLDLKPGEWA
YAPFKP
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacctcatcgccttcaacaaaccctatggcgttatctgccaattttcaccgcac
gaaaaacacaaaagcctcaaagactttatcaatcttcccggcttctaccccgccggacgg
ctcgacaccgacagcgaggggctgctgctgctgaccgacgacggcaggcttcaggcacaa
attaccgaccccaaattcaaacaccctaaaacctactgggcgcaactggagggcgtaccc
gacgaaagccgattggaaagcctaagaaaagggatagacttaggcggtttcgttacccgt
ccggcaagcatccgcatcttgaaacacggagaagcagattcgttatgggagcgcatcccg
ccgatacgcgtccgcaaaaccgttcccgatttttggattgaaattaccatttctgagggc
aaaaaccgccaagtcaggcgaatgaccgccaaggcgggctatccctgcctgcgtctgatc
agagtggcaagcggcaggctgaaactgtttgatttggatttaaaacccggggaatgggca
tacgccccgtttaaaccataa

DBGET integrated database retrieval system