KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1497
Entry
NMB1497           CDS       T00027                                 
Name
(GenBank) TonB-dependent receptor
  KO
K16087  hemoglobin/transferrin/lactoferrin receptor protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nme02000]
    NMB1497
Transporters [BR:nme02000]
 Other transporters
  Pores ion channels [TC:1]
   NMB1497
SSDB
Motif
Pfam: TonB_dep_Rec Plug
Other DBs
NCBI-ProteinID: AAF41853
UniProt: Q7DDB6
Position
1543272..1546037
AA seq 921 aa
MRSSFRLKPICFYLMGVTLYHYSYAEDAGRAGSEAQIQVLEDVHVKAKRVPKDKKVFTDA
RAVSTRQDIFKSSENLDNIVRSIPGAFTQQDKSSGIVSLNIRGDSGFGRVNTMVDGITQT
FYSTSTDAGRAGGSSQFGASVDSNFIAGLDVVKGSFSGSAGINSLAGSANLRTLGVDDVV
QGNNTYGLLLKGLTGTNSTKGNAMAAIGARKWLESGASVGVLYGHSRRSVAQNYRVGGGG
QHIGNFGAEYLERRKQRYFVQEGALKFNSDSGKWERDLQRQQWKYKPYKNYNNQELQKYI
EEHDKSWRENLAPQYDITPIDPSSLKQQSAGNLFKLEYDGVFNKYTAQFRDLNTKIGSRK
IINRNYQFNYGLSLNPYTNLNLTAAYNSGRQKYPKGSKFTGWGLLKDFETYNNAKILDLN
NTATFRLPRETELQTTLGFNYFHNEYGKNRFPEELGLFFDGPDQDNGLYSYLGRFKGDKG
LLPQKSTIVQPAGSQYFNTFYFDAALKKDIYRLNYSTNTVGYRFGGEYTGYYGSDDEFKR
AFGENSPTYKKHCNRSCGIYEPVLKKYGKKRANNHSVSISADFGDYFMPFASYSRTHRMP
NIQEMYFSQIGDSGVHTALKPERANTWQFGFNTYKKGLLKQDDTLGLKLVGYRSRIDNYI
HNVYGKWWDLNGDIPSWVSSTGLAYTIQHRNFKDKVHKHGFELELNYDYGRFFTNLSYAY
QKSTQPTNFSDASESPNNASKEDQLKQGYGLSRVSALPRDYGRLEVGTRWLGNKLTLGGA
MRYFGKSIRATAEERYIDGTNGGNTSNFRQLGKRSIKQTETLARQPLIFDFYAAYEPKKN
LIFRAEVKNLFDRRYIDPLDAGNDAATQRYYSSFDPKDKDEDVTCNADKTLCNGKYGGTS
KSVLTNFARGRTFLMTMSYKF
NT seq 2766 nt   +upstreamnt  +downstreamnt
atgagatcttctttccggttgaagccgatttgtttttaccttatgggtgttacgctatat
cattatagttatgccgaagatgcagggcgcgcgggcagcgaggcgcagatacaggttttg
gaagatgtgcacgtcaaggcgaagcgcgtaccgaaagacaaaaaagtgtttaccgatgcg
cgtgccgtatcgacccgtcaggatatattcaaatccagcgaaaacctcgacaacatcgta
cgcagcatccccggtgcgtttacacagcaagataaaagctcgggcattgtgtctttgaat
attcgcggcgacagcgggttcgggcgggtcaatacgatggtggacggcatcacgcagacc
ttttattcgacttctaccgatgcgggcagggcaggcggttcatctcaattcggtgcatct
gtcgacagcaattttattgccggactggatgtcgtcaaaggcagcttcagcggctcggca
ggcatcaacagccttgccggttcggcgaatctgcggactttaggcgtggatgacgtcgtt
cagggcaataatacctacggcctgctgctaaaaggtctgaccggcaccaattcaaccaaa
ggtaatgcgatggcggcgataggtgcgcgcaaatggctggaaagcggagcatctgtcggt
gtgctttacgggcacagcaggcgcagcgtggcgcaaaattaccgcgtgggcggcggcggg
cagcacatcggaaattttggcgcggaatatttggaacggcgcaagcagcgatattttgta
caagagggtgctttgaaattcaattccgacagcggaaaatgggagcgggatttacaaagg
caacagtggaaatacaagccgtataaaaattacaacaaccaagaactacaaaaatacatc
gaagagcatgacaaaagctggcgggaaaacctggcaccgcaatacgacattacccccatc
gatccgtccagcctgaagcagcagtcggcaggcaatctgtttaaattggaatacgacggc
gtattcaataaatacacggcgcaatttcgcgatttaaacaccaaaatcggcagccgcaaa
atcatcaaccgcaattatcagttcaattacggtttgtctttgaacccgtataccaacctc
aatctgaccgcagcctacaattcgggcaggcagaaatatccgaaagggtcgaagtttaca
ggctgggggcttttaaaggattttgaaacctacaacaacgcgaaaatcctcgacctcaac
aacaccgccaccttccggctgccccgcgaaaccgagttgcaaaccactttgggcttcaat
tatttccacaacgaatacggcaaaaaccgctttcctgaagaattggggctgtttttcgac
ggtcctgatcaggacaacgggctttattcctatttggggcggtttaagggcgataaaggg
ctgctgccccaaaaatcaaccattgtccaaccggccggcagccaatatttcaacacgttc
tacttcgatgccgcgctcaaaaaagacatttaccgcttaaactacagcaccaataccgtc
ggctaccgtttcggcggcgaatatacgggctattacggctcggatgacgaatttaagcgg
gcattcggagaaaactcgccgacatacaagaaacattgcaaccggagctgcgggatttat
gaacccgtattgaaaaaatacggcaaaaagcgcgccaacaaccattcggtcagcattagt
gcggacttcggcgattatttcatgccgttcgccagctattcgcgcacacaccgtatgccc
aacatccaagaaatgtatttttcccaaatcggcgactccggcgttcacaccgccttaaaa
ccagagcgcgcaaacacttggcaatttggcttcaatacctataaaaaaggattgttaaaa
caagatgatacattaggattaaaactggtcggctaccgcagccgcatcgacaactacatc
cacaacgtttacgggaaatggtgggatttgaacggggatattccgagctgggtcagcagc
accgggcttgcctacaccatccaacatcgcaatttcaaagacaaagtgcacaaacacggt
tttgagttggagctgaattacgattatgggcgttttttcaccaacctttcttacgcctat
caaaaaagcacgcaaccgaccaacttcagcgatgcgagcgaatcgcccaacaatgcgtcc
aaagaagaccaactcaaacaaggttatgggttgagcagggtttccgccctgccgcgagat
tacggacgtttggaagtcggtacgcgctggttgggcaacaaactgactttgggcggcgcg
atgcgctatttcggcaagagcatccgcgcgacggctgaagaacgctatatcgacggcacc
aacgggggaaataccagcaatttccggcaactgggcaagcgttccatcaaacaaaccgaa
actcttgcccgccagcctttgatttttgatttttacgccgcttacgagccgaagaaaaac
cttattttccgcgccgaagtcaaaaatctgttcgacaggcgttatatcgatccgctcgat
gcgggcaatgatgcggcaacgcagcgttattacagctcgttcgacccgaaagacaaggac
gaagacgtaacgtgtaatgctgataaaacgttgtgcaacggcaaatacggcggcacaagc
aaaagcgtattgaccaattttgcacgcggacgcacctttttgatgacgatgagctacaag
ttttaa

DBGET integrated database retrieval system