KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1498Help
Entry
NMB1498           CDS       T00027                                 

Gene name
lysC
Definition
(RefSeq) aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00260  Glycine, serine and threonine metabolism
nme00261  Monobactam biosynthesis
nme00270  Cysteine and methionine metabolism
nme00300  Lysine biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01210  2-Oxocarboxylic acid metabolism
nme01230  Biosynthesis of amino acids
Module
nme_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
nme_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMB1498 (lysC)
   00270 Cysteine and methionine metabolism
    NMB1498 (lysC)
   00300 Lysine biosynthesis
    NMB1498 (lysC)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    NMB1498 (lysC)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     NMB1498 (lysC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase ACT ACT_7 Fe_hyd_lg_C SIS_2
Motif
Other DBs
NCBI-GeneID: 903923
NCBI-ProteinID: NP_274506
UniProt: Q9JYN6
Structure
PDB: 

Position
complement(1548041..1549258)
Genome map
AA seq 405 aa AA seqDB search
MALIVHKYGGTSVGSPERIKNVAKRVAKARAEGHDIVVVVSAMSGETNRLVALAHEMQEH
PDPRELDVVLATGEQVTIGLLAMALKDIGVDAKSYTGWQVALKTDTAHTKARIESIDDEK
MRADLTAGKVVIVAGFQGISSEGDISTLGRGGSDTSAVALAAALKADECQIYTDVDGVYT
TDPRVVPEARRMDTVTFEEMIELASLGSKVLQIRSVEFAGKYKVRLRVLSSLQDGGNGTL
ITFEEDDNMERAAVTGIAFDKNQARINVRGVPDKPGVAYQILGAVADANIEVDMIIQNVG
SEGTTDFSFTVPRGDYKQTLEILSERQDSIGAASIDGDDTVCKVSAVGLGMRSHVGVAAK
IFRTLAEEGINIQMISTSEIKVSVLIDEKYMELATRVLHKAFNLG
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcgttaatcgtacataaatacggcggcacatcagtaggctcgcccgaacgcatcaaa
aacgtagccaaacgtgtcgccaaagcccgcgccgaaggacacgacatcgtagtcgtcgta
tccgccatgagcggcgaaaccaaccgactggtcgcactggcgcacgaaatgcaagagcat
cccgatccgcgcgagctggacgtcgtcttagctaccggcgaacaagtaaccatcggcctt
ttggcgatggcattgaaagacatcggcgtggatgccaaaagctacacaggctggcaggtc
gccctcaaaaccgataccgcccacaccaaagcccgcatcgaaagcattgatgacgaaaaa
atgcgtgccgaccttaccgccggcaaagtcgtcatcgttgccggcttccaaggcatcagc
agtgaaggcgatatttccacgctcggacgcggcggttccgacacttccgccgtcgcgctt
gccgccgcgctcaaagccgacgagtgccaaatctataccgacgtagacggcgtttacaca
accgacccccgcgtcgtacccgaagcgcgccgcatggatacggttacatttgaagaaatg
atcgaactggcaagcctcggttcgaaagttttgcaaatccgttcagtagaattcgccgga
aaatacaaagtgcgcctgcgcgtactgagcagcctgcaagacggcggcaatggcacctta
attacctttgaagaggacgacaacatggaaagagctgccgtaaccggtatcgcattcgat
aaaaaccaagcccgcatcaacgtgcgcggcgtacccgacaaacctggcgtcgcctatcag
attttaggcgcggttgccgatgccaacatcgaagtcgatatgattatccaaaatgtcggc
agcgaaggcacaaccgatttttcctttaccgtaccgcgcggcgattacaagcagactttg
gaaatcctgtcggaacgccaagacagtatcggcgcggcttctattgatggcgacgacacc
gtatgcaaagtctccgcagtcggtttgggtatgcgttcgcacgtcggtgtagccgccaaa
atcttccgcacgctcgccgaagagggtatcaacatccaaatgatttccacctccgaaatc
aaagtttccgtattgattgatgaaaaatacatggaactggcaaccagggtattgcataaa
gcctttaatttgggctga

DBGET integrated database retrieval system