KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1511Help
Entry
NMB1511           CDS       T00027                                 

Gene name
rpiA
Definition
(RefSeq) ribose-5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00030  Pentose phosphate pathway
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
nme01230  Biosynthesis of amino acids
Module
nme_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
nme_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NMB1511 (rpiA)
Enzymes [BR:nme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     NMB1511 (rpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC
Motif
Other DBs
NCBI-GeneID: 903979
NCBI-ProteinID: NP_274519
UniProt: Q9JYM6
Position
complement(1561301..1561972)
Genome map
AA seq 223 aa AA seqDB search
MTTQDELKRIAAEKAVEFVPENEYIGIGTGSTINFFIEALGKSGKKIKGAVSTSKKSGEL
LAQYDIPVVSLNEVSGLAVYIDGADEVNHALQMIKGGGGAHLNEKIVASASEKFICIADE
SKYVSRLGKFPLPVEVVESARSLVSRKLLAMGGQPELRIGYTTFYGNQIVDVHGLNIDQP
LTMEDEINKITGVLENGIFARDAADVLILGTEEGAKVIYPCQG
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgacgacacaagacgaactcaagcgcatcgccgccgaaaaagcagtcgaattcgtaccc
gaaaatgaatatatcggcatcggtaccggctcgaccatcaactttttcatcgaagccttg
ggtaagagcggcaaaaaaatcaaaggcgcggtatctacttccaaaaaatccggcgaactg
cttgcccagtacgatattcccgtcgtttctttgaacgaagtatcggggttggcggtctat
atcgacggtgcggatgaagtgaaccacgccctgcaaatgattaaaggcggtggcggcgcg
cacctcaacgaaaaaatcgtcgccagcgcgtccgaaaaattcatctgcattgcggatgaa
agcaaatatgtttcacgtttgggcaaattccctctgcctgtggaagtcgtcgaaagcgcg
cgctctcttgtttcgcgcaaactgctcgctatgggcggacagcccgaactgcgtatcggc
tacaccacgttttacggcaaccaaatcgtcgatgtccacggcttgaatatcgatcagccg
ctgacgatggaagacgaaatcaacaaaatcaccggcgtgctcgaaaacggcatattcgcc
cgcgatgccgccgatgtgttgattttggggacggaagagggtgcgaaagtcatctatccc
tgccaagggtaa

DBGET integrated database retrieval system