KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1513Help
Entry
NMB1513           CDS       T00027                                 

Gene name
ispD
Definition
(RefSeq) 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
  KO
K00991  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC:2.7.7.60]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00900  Terpenoid backbone biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NMB1513 (ispD)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.60  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
     NMB1513 (ispD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IspD NTP_transf_3 AbiEii
Motif
Other DBs
NCBI-GeneID: 903982
NCBI-ProteinID: NP_274521
UniProt: Q9JYM4
Position
complement(1562563..1563252)
Genome map
AA seq 229 aa AA seqDB search
MKRKNIALIPAAGIGARFGADKPKQYVEIGSKTVLEHTIGIFERHEAVDLTVVVVSPEDT
FADKVQTAFPQVRVWKNGGQTRAETVRNGVAKLLETGLAAETDNILVHDAARCCLPSEAL
TRLIEQAGNAAEGGILAIPIADTLKCADGGNISATVERTSLWQAQTPQLFRAGLLHRALA
AENLDGITDEASAVEKLGVRPLLIQGDVRNLKLTQPQDAYIVRLLLDAV
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcaaaaatatcgcgctgattcccgccgccggcatcggggcgcgtttcggtgcg
gacaaacccaagcaatatgtcgaaatcggaagcaaaaccgttttagaacatacgattggg
atttttgaacggcatgaggccgtcgatttgaccgtcgttgtcgtctcgcccgaagacacg
tttgccgataaggttcagacggcatttccacaggttcgggtgtggaaaaacggcggacag
acccgcgccgaaaccgtccgcaacggtgtggcaaaactgttggaaaccggtttggcggcg
gaaaccgacaatattctggtacacgatgccgcgcgttgctgcctgccgtctgaagctttg
acgcggttgatagaacaggcgggcaacgccgccgaaggcgggattttggcaattcccatt
gccgatacgctcaagtgcgcggacggtgggaacattagtgcaaccgtcgagcggacgagc
ctttggcaggcgcaaacgccgcagcttttccgcgccgggctgctgcaccgcgcattggct
gcggaaaacttggacggcattaccgatgaagcgtccgccgtggaaaaattgggtgtgcgt
ccgctactgatacagggcgacgtgcgcaatttgaaactgacgcagccgcaggacgcatac
atcgtcaggctgctgctcgatgccgtctga

DBGET integrated database retrieval system