KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1527Help
Entry
NMB1527           CDS       T00027                                 

Gene name
rfaF
Definition
(RefSeq) ADP-heptose--LPS heptosyltransferase
  KO
K02843  heptosyltransferase II [EC:2.4.-.-]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00540  Lipopolysaccharide biosynthesis
nme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    NMB1527 (rfaF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:nme01003]
    NMB1527 (rfaF)
   01005 Lipopolysaccharide biosynthesis proteins [BR:nme01005]
    NMB1527 (rfaF)
Enzymes [BR:nme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.-  Glycosyltransferases
    2.4.-.-  
     NMB1527 (rfaF)
Glycosyltransferases [BR:nme01003]
 Polysaccharide
  Bacterial polysaccharide
   NMB1527 (rfaF)
Lipopolysaccharide biosynthesis proteins [BR:nme01005]
 Core region
  NMB1527 (rfaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_9 Thioredoxin_9 Pellino
Motif
Other DBs
NCBI-GeneID: 904029
NCBI-ProteinID: NP_274534
UniProt: Q9JYL5
Position
complement(1577174..1578184)
Genome map
AA seq 336 aa AA seqDB search
MSIKILIISPSWIGDCVMTQPLFRRLKELHPGCTIDVFAPKWSMAVFERMPEVNEILENS
FGHGALELKRRWRVGRDLGRRGYDQVIVLPGSLKSAIIALATGIGKRTGYVGESRYFLLN
DIRRLDKERLPLMVDRYTALAHPSQEDFDGHSGFPEFSIDERRREISVETFGLDIGKPVL
AFCPGAEFGPAKRWPTRHFAELGKHYLAAGWQVWLFGSQKDDEIAEEINRLSDGMCVNLC
GKTDLSQAMDLLSLADTVVCNDSGLMHLAAALGRKVVAVYGSSSPTHTPPLSDRAKIVSL
HLECSPCFKRECPLGHTDCLNRLYPEKIVQAVEEAV
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcaaaatcctgattatttcccccagttggataggcgactgcgtgatgacccag
cccttgttccgccgtttgaaggaacttcaccccggttgcacgattgatgtgttcgcaccg
aagtggtcgatggcggtgttcgagcgtatgccggaagtgaatgaaattcttgagaattcg
ttcggacatggtgcgttggagttgaaacgccgttggcgggtcggtagggatttggggcgg
cgcggatacgatcaggttatcgtgttgcccggttctttgaaatcggcaatcatcgcgctg
gcgacaggtatcggtaaaaggacgggttatgtcggtgaaagccgttattttctgttgaac
gatatacgcaggctggataaggaacgtctgcctttgatggtggatcgatatacggctctc
gcgcatccgagtcaggaagattttgacgggcattcgggattccccgagttttccattgat
gaacggcggcgggaaatttctgtcgaaacctttggcttggatattggaaagcctgttctg
gctttttgtccgggtgcggaattcgggccggcaaagcgttggccgacaaggcattttgcc
gagttgggcaaacattatctggcggcgggttggcaggtttggctgttcggttcgcaaaaa
gatgatgaaattgccgaggaaatcaaccgcctttcagacggtatgtgtgtcaatttgtgc
ggcaaaaccgatttgtcgcaggcaatggatttgctgtcgttggcggacacggtcgtgtgt
aacgacagcggattgatgcatttggcggcagctttgggcaggaaggtggtggcggtttac
ggttcttccagcccgacgcatacgccgcctttgagcgatagggcgaaaatcgtcagcctg
cacttggaatgttcgccgtgttttaagcgggaatgtccgctggggcataccgactgcctc
aacaggctgtatcccgagaagattgtgcaggcggttgaagaggcggtatga

DBGET integrated database retrieval system