KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1530Help
Entry
NMB1530           CDS       T00027                                 

Gene name
dapE
Definition
(RefSeq) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00300  Lysine biosynthesis
nme01100  Metabolic pathways
nme01120  Microbial metabolism in diverse environments
nme01230  Biosynthesis of amino acids
Module
nme_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    NMB1530 (dapE)
Enzymes [BR:nme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     NMB1530 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-GeneID: 904046
NCBI-ProteinID: NP_274537
UniProt: Q9JYL2
Structure
PDB: 

Position
complement(1581121..1582266)
Genome map
AA seq 381 aa AA seqDB search
MTETQSLELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGDTKNIWLRRGTKA
PVVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACERFVAKH
PNHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMIKNGRR
GSLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNING
GTGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDKHGVQYDLQWSCSGQPFLTQAG
KLTDVARAAIAETCGIEAELSTTGGTSDGRFIKAIAQELIELGPSNATIHQINENVRLND
IPKLSAVYEGILARLLAGNAV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaactcaatccctagagcttgccaaagagctgatttcccgaccatccgttacc
cctgacgacagggattgccaaaaactccttgccgaacgcctgcacaaaatcggttttgcg
gctgaagaactccatttcggcgacaccaaaaacatctggttgcgacgcggcacgaaagct
cccgtcgtctgttttgcagggcataccgacgttgtaccgacaggtcctgtcgaaaaatgg
gattcgcccccgttcgaaccggccgagcgcgacggaagattatacgggcgcggcgcggca
gacatgaaaaccagcattgcctgtttcgttaccgcctgcgaacgcttcgttgccaaacat
cccaaccaccaaggcagcattgcgcttctgattacttccgacgaagagggcgacgcgttg
gacggcacgaccaaagtcgtcgatgtattgaaagcgcgcgacgagcttatcgactactgc
atcgtcggcgaaccgaccgccgtggacaaattgggcgatatgattaaaaacggtcggcgc
ggctcgctgtcgggcaacctgaccgtcaaaggcaagcaaggccatattgcctatccgcat
ttggcaatcaatcccgtgcatacttttgccccggccttgttagagctgacgcaggaagtc
tgggatgaaggcaacgaatatttcccgccaaccagctttcaaatttccaatatcaacggc
ggcacaggcgcgaccaacgtcattccgggcgagctgaacgtcaaattcaatttccgcttc
tccaccgagtccaccgaagcagggctgaaacaacgcgtccacgccattttggacaaacac
ggcgtgcaatacgatttgcagtggtcgtgttcggggcagccctttctgacccaagcgggc
aaactgaccgacgtggcacgcgcagccattgccgaaacctgcggcattgaggccgaattg
tccaccaccggcggcacttcggacggacgcttcatcaaagccattgcgcaagaacttatc
gaattaggcccgtccaatgcgaccatccaccaaatcaacgaaaacgtgcggctaaacgac
attccgaagctgtctgcggtgtatgaggggatattggcgcgcttgttggctggaaatgcc
gtctga

DBGET integrated database retrieval system