KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1555Help
Entry
NMB1555           CDS       T00027                                 

Gene name
fadD-2
Definition
(RefSeq) long-chain-fatty-acid--CoA-ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00061  Fatty acid biosynthesis
nme00071  Fatty acid degradation
nme01100  Metabolic pathways
nme01212  Fatty acid metabolism
nme02024  Quorum sensing
Module
nme_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NMB1555 (fadD-2)
   00071 Fatty acid degradation
    NMB1555 (fadD-2)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    NMB1555 (fadD-2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nme01004]
    NMB1555 (fadD-2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nme04147]
    NMB1555 (fadD-2)
Enzymes [BR:nme01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     NMB1555 (fadD-2)
Lipid biosynthesis proteins [BR:nme01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   NMB1555 (fadD-2)
Exosome [BR:nme04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   NMB1555 (fadD-2)
  Exosomal proteins of breast cancer cells
   NMB1555 (fadD-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2 DUF4235
Motif
Other DBs
NCBI-GeneID: 904112
NCBI-ProteinID: NP_274562
UniProt: Q9JYJ7
Position
complement(1614034..1615704)
Genome map
AA seq 556 aa AA seqDB search
MEKIWLDSYEKGVSAEIDITQYNSVSDVFRQSVEKFADQPAFQNMGKTLTYAETGKLATD
FASYLQNVLKLPRGERVAIMLPNVLQYPVALFGILQAGLVAVNTNPLYTPRELEHQLKDS
GATAIIVLENFANTLELVLPRTQIKHVIVASVGEMFGLLKGSLINFVIRKIKKMVPEYRI
RETVSFQTALKEGAKHVFQPVALNREDTALLQYTGGTTGVAKGAVLSHGNICANMLQAKE
WIKNQLREGKETVIAALPLYHIFALTVNLMIFANAGSKIILITNPRDMKGFIGELKKQRV
NVFIGVNTLFNAMVNRPDFAEVDFSELRLTLGGGMATQKAVAEKWKKITGTPIVEAYGLT
EASPGVCCNPLNIESYSGSIGLPVSSTEVELRDANGKEVPVGQPGELWVKGPQVMQGYWN
RPEETAKAIDARGFLETGDIAVMDEKGWLKLVDRKKDLVVVSGFNVYPNEIEEVIAHHGK
VMEVACIGVPDEKTGEALKVFVVKKDPSLTKEELIAFCRTELTAYKVPKNIEFRDELPKS
NVGKILRRELRQSTGK
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatctggttagacagctacgagaagggcgtcagtgccgaaatcgacatcacg
caatacaattccgtcagcgacgtattccgccaaagcgtggaaaaatttgccgaccaacct
gcttttcaaaacatgggtaagacgctgacttatgccgaaaccggcaaactggcaacagat
tttgcttcttatctgcaaaacgtccttaaattgcctcgaggagagcgcgtggcaataatg
ttgcccaatgtactgcaatatccggttgcccttttcggcattttgcaggcaggtttggta
gcggtgaacaccaatccgctctataccccgcgcgagctggagcatcagttgaaagacagc
ggcgcgaccgccatcatcgttttggaaaatttcgccaacacgctggagctggtgctgccg
cgcacgcagatcaaacacgtcatcgtagcctccgtcggcgaaatgttcgggctgcttaaa
ggttcgctgatcaatttcgtcatccggaaaatcaagaaaatggtgcccgaataccgtatt
cgggaaaccgtttcctttcagacggcattgaaagaaggggcgaagcacgttttccaacct
gtcgcattaaaccgcgaagataccgcgctgttgcaatacacgggcggcacgacaggtgtt
gccaaaggggcggtgctgagtcacggcaacatctgcgccaatatgcttcaggcaaaagaa
tggattaaaaaccagttgcgcgagggcaaagaaaccgttatcgccgccttgccgctgtac
catatttttgccttaaccgtgaatctgatgatttttgccaatgccggctcgaaaatcatc
ctgattaccaacccgcgcgatatgaaaggctttatcggagaactgaaaaaacagcgggtt
aatgtatttatcggcgtgaacacgctgtttaacgcgatggttaaccgtcctgattttgcc
gaagtcgatttttcagaattgcggctgactttgggcggcggtatggcgacccaaaaagcc
gttgccgaaaaatggaaaaaaatcaccggcacgcccatcgtcgaagcctacggtctgacc
gaagccagccccggcgtgtgctgcaaccccttaaacatcgaatcatacagcggcagcatc
ggtttgcccgtctcgtccaccgaagtcgaactgcgcgacgcaaacggcaaagaagtcccc
gtcgggcagccgggcgaattgtgggtaaaaggccctcaagtgatgcaaggctactggaac
cgccccgaagaaaccgccaaagccatagacgcgcgcggcttcttggaaaccggcgatatt
gccgtcatggacgaaaaaggctggttgaagctggtcgatcgtaagaaagacctcgtcgtt
gtttccggattcaatgtttatccgaacgaaatcgaggaagtcatcgcgcatcacggcaaa
gtcatggaagtcgcctgtatcggcgttcccgacgaaaaaaccggcgaggcactcaaagta
ttcgtcgtcaaaaaagacccgtctttgaccaaagaagaacttatcgctttttgccgcacc
gaattaaccgcatataaagtaccgaaaaatatcgaattccgcgacgagttgcccaagtcc
aacgtcggcaaaatcctgcgccgcgagttgcggcaaagtaccgggaaataa

DBGET integrated database retrieval system