KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1566Help
Entry
NMB1566           CDS       T00027                                 

Gene name
purN
Definition
(RefSeq) phosphoribosylglycinamide transformylase
  KO
K11175  phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00230  Purine metabolism
nme00670  One carbon pool by folate
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
Module
nme_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NMB1566 (purN)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    NMB1566 (purN)
Enzymes [BR:nme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     NMB1566 (purN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N
Motif
Other DBs
NCBI-GeneID: 904144
NCBI-ProteinID: NP_274573
UniProt: Q9JYI9
Position
complement(1625693..1626319)
Genome map
AA seq 208 aa AA seqDB search
MKNIVILISGRGSNMQAIVNAAIHNVRIAAVLSNSETAAGLQWAAERGIPTDSLNHKNFT
SRLAFDTAMMEKIDAYQPDLVVLAGFMRILTPEFCARYEGRLMNIHPSILPSFTGLHTHE
RALEAGCRVAGCTIHFVTAELDCGPIVSQGVVPILDGDTADDIAARVLAVEHKLYPKAVA
DFAAGRLIIEGNRVRNSENADAARFLTA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacatcgtcatcctgatttctggacgcggcagcaatatgcaggcaatcgtcaat
gccgccattcacaacgtccgcattgccgccgtgttgagcaacagcgaaacggctgccggt
ttgcaatgggcggccgaacgcggcatcccgaccgatagcctgaatcataaaaactttaca
tcccggcttgccttcgataccgccatgatggagaaaatcgacgcatatcaacccgacttg
gtggttttggcaggttttatgcggattctgacccccgagttttgcgcccgttacgaaggc
aggctgatgaacattcacccgtccatccttccctcgtttaccggacttcatacgcacgaa
cgcgctttggaggcgggctgccgcgttgccggctgcaccatccatttcgttactgccgaa
ctggattgcggcccgattgtatcgcaaggggttgtgccgatactcgacggcgatacggca
gacgatattgccgcacgggttttggctgtcgagcataaactttatccgaaagccgttgcc
gattttgccgccggccgcctgattattgagggaaaccgcgtcagaaattcggaaaacgcc
gatgccgcccgttttctgacggcgtaa

DBGET integrated database retrieval system