KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1572Help
Entry
NMB1572           CDS       T00027                                 

Gene name
acnB
Definition
(RefSeq) aconitate hydratase B
  KO
K01682  aconitate hydratase 2 / 2-methylisocitrate dehydratase [EC:4.2.1.3 4.2.1.99]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00020  Citrate cycle (TCA cycle)
nme00630  Glyoxylate and dicarboxylate metabolism
nme00640  Propanoate metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
nme01210  2-Oxocarboxylic acid metabolism
nme01230  Biosynthesis of amino acids
Module
nme_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nme_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMB1572 (acnB)
   00630 Glyoxylate and dicarboxylate metabolism
    NMB1572 (acnB)
   00640 Propanoate metabolism
    NMB1572 (acnB)
Enzymes [BR:nme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     NMB1572 (acnB)
    4.2.1.99  2-methylisocitrate dehydratase
     NMB1572 (acnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase_2_N Aconitase_B_N Aconitase DUF4941 DUF521
Motif
Other DBs
NCBI-GeneID: 904159
NCBI-ProteinID: NP_274578
UniProt: Q9JYI4
Position
1631974..1634559
Genome map
AA seq 861 aa AA seqDB search
MLEAYRKAAAERAALGIPALPLNAQQTADLVELLKSPPAGEGEFLVELLAHRVPPGVDDA
AKVKASFLAAVAEGSASSPLISPEYATELLGTMLGGYNIHALIELLDDDKLASIAAKGLK
HTLLMFDSFHDVQEKAEKGNKYAQEVLQSWADAEWFASRAKVPEKITVTVFKVDGETNTD
DLSPAPDAWSRPDIPLHALAMLKNPRDGITPDKPGEVGPIKLLEELKAKGHPVAYVGDVV
GTGSSRKSATNSVIWHTGEDIPFVPNKRFGGVCLGGKIAPIFFNTQEDSGALPIEVDVSA
LKMGDVVDILPYEGKIVKNGETVAEFELKSQVLLDEVQAGGRINLIIGRGLTAKAREALK
LPASTAFRLPQAPAESKAGFTLAQKMVGRACGLPEGQGVRPGTYCEPRMTTVGSQDTTGP
MTRDELKDLACLGFSADMVMQSFCHTAAYPKPVDVKTHKELPAFISTRGGVSLRPGDGVI
HSWLNRLLLPDTVGTGGDSHTRFPIGISFPAGSGLVAFAAATGVMPLDMPESVLVRFSGK
LQPGVTLRDLVNAIPLYAIKQGLLTVAKAGKKNIFSGRILEIEGLPDLKVEQAFELTDAS
AERSAAGCTVKLNKEPIIEYMKSNVVLMKNMIANGYQDPRTLERRIKAMEKWLANPELLE
ADKDAEYAAVIEINMDDIKEPIIACPNDPDDVCFMSERSGTKIDEVFIGSCMTNIGHFRA
ASKLLEGKADTPVRLWIAPPTKMDAKQLSDEGHYGVLGRAGARMEMPGCSLCMGNQAQVR
EGATVMSTSTRNFPNRLGKNTFVYLGSAELAAICSKLGKIPTVEEYQANIGIINEQGDKI
YRYMNFNEIDSYNEVAETVNV
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atgttagaagcctatcgtaaagccgccgccgagcgcgccgccctcggcattcccgccctc
cctttgaacgcgcagcaaaccgccgatttggttgagctgctgaaaagcccgcccgcaggc
gaaggcgagttcttggtcgaactgcttgcccaccgtgttccgcccggtgtggacgatgcc
gccaaagtcaaagcctcattcctggctgccgttgccgaaggcagcgcgtccagcccgctg
atctcccccgaatatgcgaccgaactcttaggtacaatgctcggcggttacaatattcac
gccttaatcgaactcttggacgacgacaaactcgcgtccattgctgccaaaggcttgaaa
catacgcttctgatgttcgattccttccacgacgttcaagaaaaagccgaaaaaggcaac
aaatacgcgcaagaagttttgcaatcttgggcagatgccgaatggttcgcctcacgcgcc
aaagttcccgaaaaaatcaccgttaccgttttcaaagttgacggcgaaaccaatacagac
gacctctcccccgcgcccgacgcgtggagtcgtcccgatattccgctgcacgcgctggcc
atgctgaaaaacccgcgcgacggcatcacgcccgacaaaccgggcgaagtcggtccgatt
aaattgttggaagaactcaaagccaaaggccatccggttgcttacgtcggcgacgtggtc
ggtactggttcttcacgcaaatccgcgaccaactccgtcatttggcataccggcgaagac
attccgttcgtgccgaacaaacgcttcggcggcgtatgtttgggcggcaaaatcgcgccg
attttcttcaatacccaagaagattccggcgcgctgccgattgaagtcgatgtatctgct
ctaaaaatgggcgatgtcgtcgatatcctgccttatgaaggcaaaatcgtgaaaaacggc
gagactgttgccgagtttgaattgaaatcacaagtattgctggacgaagtgcaagccggc
ggccgtatcaacctgattatcggccgaggtctgaccgccaaagcgcgcgaagccctgaaa
ctgcctgcctctactgcattccgcctgccgcaagcgcctgccgaaagcaaagccggtttc
accttggcgcaaaaaatggtcggccgcgcctgcggtctgcccgaaggacaaggcgtgcgc
ccgggtacttactgcgaaccgcgtatgacgacggtcggctcgcaagacacgaccggcccg
atgacccgcgacgagttgaaagacttggcttgtttgggcttctccgccgatatggtgatg
cagtctttctgccacaccgccgcctatccgaaacctgtcgatgtaaaaacccataaagaa
ctgcccgcctttatttccacccgtggcggcgtgtcactgcgtccgggcgacggcgtcatc
cactcgtggctcaaccgcctgctgctgcccgataccgtcggcaccggcggcgacagccat
acccgtttccccatcggtatttccttccccgccggctccggcttggttgcctttgccgcc
gcaacgggcgtaatgccgctcgatatgcccgagtctgtattggtacgcttcagcggcaag
ctgcaaccgggcgtaaccctgcgcgatttggtgaacgccatcccgctgtacgcaatcaaa
caaggtttgctgaccgttgccaaagccggtaagaaaaacatcttctccggccgcatcctc
gaaatcgaaggcctgcctgatttgaaagtggaacaagcctttgaattgaccgacgcatcc
gccgaacgctccgccgccggctgtaccgtgaagctcaacaaagagccgattatcgagtac
atgaaatccaacgtcgtgttgatgaaaaacatgattgccaacggctatcaagacccgcgc
actttggaacgccgcatcaaagctatggaaaaatggctggcaaatcccgagttgctcgaa
gcggataaagatgccgaatacgccgccgtgattgaaatcaacatggacgacatcaaagag
ccgattatcgcctgcccgaacgacccggacgacgtgtgcttcatgtccgaacgctccggc
accaaaatcgacgaagtattcatcggttcgtgtatgaccaacatcggccacttccgcgcc
gcctccaaacttttggaaggcaaggcagacacccccgtccgcctgtggattgcgccgccg
accaaaatggacgcgaaacaattgtccgacgaaggacactacggcgtactcggacgtgcc
ggcgcgcgtatggaaatgccgggttgctccttatgtatgggtaatcaggcgcaagtacgc
gaaggtgcgaccgttatgtccacctccacccgcaacttcccgaaccgtttgggtaaaaac
acctttgtttacctcggttcggcggaattggcagcgatttgctccaaactgggtaaaatc
ccgaccgttgaagaatatcaagccaatatcggcatcatcaacgaacagggcgataaaatc
taccgctatatgaacttcaacgaaatcgacagctacaacgaagtagccgagaccgtgaac
gtttaa

DBGET integrated database retrieval system