KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1574Help
Entry
NMB1574           CDS       T00027                                 

Gene name
ilvC
Definition
(RefSeq) ketol-acid reductoisomerase
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00290  Valine, leucine and isoleucine biosynthesis
nme00770  Pantothenate and CoA biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
nme01210  2-Oxocarboxylic acid metabolism
nme01230  Biosynthesis of amino acids
Module
nme_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
nme_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    NMB1574 (ilvC)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    NMB1574 (ilvC)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     NMB1574 (ilvC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IlvN IlvC 2-Hacid_dh_C F420_oxidored NAD_binding_2 AdoHcyase_NAD CoA_binding ApbA PDH Rossmann-like CoA_binding_2 Mur_ligase
Motif
Other DBs
NCBI-GeneID: 904172
NCBI-ProteinID: NP_274580
UniProt: Q9JYI2
Position
complement(1635920..1636933)
Genome map
AA seq 337 aa AA seqDB search
MQVYYDKDADLSLIKGKTVAIIGYGSQGHAHAANLKDSGVNVVIGLRQGSSWKKAEAAGH
VVKTVAEATKEADVVMLLLPDETMPAVYHAEVTANLKEGATLAFAHGFNVHYNQIVPRAD
LDVIMVAPKGPGHTVRSEYKRGGGVPSLIAVYQDNSGKAKDIALSYAAANGGTKGGVIET
TFREETETDLFGEQAVLCGGVVELIKAGFETLTEAGYAPEMAYFECLHEMKLIVDLIFEG
GIANMNYSISNNAEYGEYVTGPEVVNASSKEAMRNALKRIQTGEYAKMFIQEGNVNYASM
TARRRLNADHQVEKVGAQLRAMMPWITANKLVDQDKN
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtctattacgataaagatgccgatctgtccctaatcaaaggcaaaaccgttgcc
atcatcggttacggttcgcaaggtcatgcccatgccgccaacctgaaagattcgggtgta
aacgtggtgattggtctgcgccaaggttcttcttggaaaaaagccgaagcagccggtcat
gtcgtcaaaaccgttgctgaagcgaccaaagaagccgatgtcgttatgctgctgctgcct
gacgaaaccatgcctgccgtctatcacgccgaagttacagccaatttgaaagaaggcgca
acgctggcatttgcacacggcttcaacgtgcactacaaccaaatcgttccgcgtgccgac
ttggacgtgattatggttgcccccaaaggtccgggccataccgtacgcagtgaatacaaa
cgcggcggcggcgtgccttctctgattgccgtttaccaagacaattccggcaaagccaaa
gacatcgccctgtcttatgcggctgccaacggcggcaccaaaggcggtgtgattgaaacc
actttccgcgaagaaaccgaaaccgatctgttcggcgaacaagccgtattgtgcggcggc
gtggtcgagttgatcaaggcgggttttgaaaccctgaccgaagccggttacgcgcctgaa
atggcttacttcgaatgtctgcacgaaatgaaactgatcgttgacctgattttcgaaggc
ggtattgccaatatgaactactccatttccaacaatgcggagtacggcgaatacgttacc
ggccctgaagtggtcaatgcttccagcaaagaagccatgcgcaatgccctgaaacgcatt
caaaccggcgaatacgcaaaaatgtttatccaagagggtaatgtcaactatgcgtctatg
actgcccgccgccgtctgaatgccgaccaccaagttgaaaaagtcggcgcacaactgcgt
gccatgatgccttggattactgccaacaaattggttgaccaagacaaaaactga

DBGET integrated database retrieval system