KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1577Help
Entry
NMB1577           CDS       T00027                                 

Gene name
ilvI
Definition
(RefSeq) acetolactate synthase isozyme III large subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00290  Valine, leucine and isoleucine biosynthesis
nme00650  Butanoate metabolism
nme00660  C5-Branched dibasic acid metabolism
nme00770  Pantothenate and CoA biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
nme01210  2-Oxocarboxylic acid metabolism
nme01230  Biosynthesis of amino acids
Module
nme_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
nme_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NMB1577 (ilvI)
   00660 C5-Branched dibasic acid metabolism
    NMB1577 (ilvI)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    NMB1577 (ilvI)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    NMB1577 (ilvI)
Enzymes [BR:nme01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     NMB1577 (ilvI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M PPS_PS DUF1614 POR_N KdpD
Motif
Other DBs
NCBI-GeneID: 904184
NCBI-ProteinID: NP_274583
UniProt: Q9JYI0
Position
complement(1637875..1639602)
Genome map
AA seq 575 aa AA seqDB search
MQLSGAQIIVQSLKAEGVEYVFGYPGGAVIEIYDALFQLNKFKHILTRHEQAAVHAADAY
ARVSGKVGVALVTSGPGVTNALTGIATAYTDSIPMVVISGQVGNSLIGTDAFQEVDTVGI
TRPCVKHNFLVTDINELAETIKKAFQIAASGRPGPVVVDVPKDVTQAMAKFSYPQEDIFI
RSYQPVVQGHIGQIKKAVQMLASAKRPVVYFGGGVVLGNASEELTRFVRMTGAPCTGTLM
GLGAYPSGDRQFLGMLGMHGTYEANLAMQNADVVLAVGARFDDRVVSVPSKFFEKAKKVI
HIDVDPSSIAKRVKVDIPIVGDVKNVLSEMVALWQKQESVPSEDALGKWWKTIEEWRSRD
CLWFDNGSEIIKPQYVIQKLAEITGNSAIITSDVGQHQMFAAQYYPFERPRQWLNSGGLG
TMGVGLPYAIGAKLAAPDQDVFCITGDGSIQMNIQELSTCFQYRIPVNVITLNNGYLGMV
RQWQEIYYGGRESETYFDSLPDFVKLAEAYGHIGIRVDKKSDVEGALLEALNQKDRLVFI
DFLTDQKQNVMPMVGNGKGLDEMVLPPHMRADGKA
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgcagttatcaggcgcgcaaatcatagtgcagagtctcaaagccgaaggtgtcgagtac
gttttcggttatcccggcggtgcggttatcgaaatctacgatgcccttttccaactcaat
aaattcaaacacattcttacccgccatgagcaggcggcagtacacgcggcagatgcgtat
gcgcgcgtcagcggtaaggtgggcgtggcattggttacatccggcccgggcgttaccaat
gcactgaccggtattgctactgcctatacggattcgattccgatggtggtcatcagcggg
caggtaggcaattccctgattggtacggatgcgttccaagaagttgatacggtgggtatt
acccgtccgtgcgtcaaacacaatttcctggttacggacatcaatgagttggcggaaacc
attaaaaaggcgttccaaattgccgcaagcggccgaccggggcccgtggtggttgatgtc
ccgaaagatgttacgcaggcgatggcgaaattcagctatcctcaggaagacatttttatc
cgttcgtatcaaccggttgttcaaggacatatcggtcagattaaaaaggccgtgcagatg
ttggcatctgccaaacgtccggtcgtctattttggcggcggcgtggtgttgggtaatgct
tctgaagagctgacccgatttgtccgaatgacgggtgctccgtgcacgggtacgctgatg
ggcttgggcgcttatccttccggcgaccgccaattcctcggtatgctcggtatgcacggt
acttacgaggcaaaccttgccatgcagaatgcggatgtcgttcttgccgtaggtgcgcgt
tttgacgaccgtgtggtttccgtaccgtccaaatttttcgagaaggcgaagaaggttatc
catatcgatgtcgatccttccagcatcgccaaacgcgtgaaggtggacattccgattgtc
ggcgacgtgaaaaacgttttgtccgagatggttgcgctgtggcaaaaacaagagtccgtg
ccgtctgaagatgctttgggcaaatggtggaaaaccatagaggaatggcgttcccgagat
tgcttgtggtttgacaacggcagcgaaattatcaagccacaatatgtgattcagaagctt
gccgagattaccggcaattcggcaatcatcacatcggatgtagggcagcatcaaatgttt
gcggctcaatattatcccttcgaacgtccgcgccaatggctcaattccggcggtttgggt
acgatgggcgtgggtctgccttatgcgattggtgcaaaacttgccgccccggatcaagac
gtattctgtatcaccggcgacggctcgatccagatgaacatccaagagctgtccacctgt
ttccaatatcggattccggttaacgtcattacgctgaacaacggttatctcggtatggta
cgccagtggcaggaaatatattacggcggacgagagtcggaaacctatttcgattctttg
cccgatttcgtcaaacttgccgaggcatacggccatatcggtatccgcgtggacaagaag
tctgatgtggaaggtgcgttgttggaagcattgaaccaaaaagacaggctggtgtttatc
gacttcctgaccgaccagaaacagaatgtgatgcccatggtcggcaacggcaaaggtttg
gacgaaatggtacttccgccgcatatgcgtgcggacggaaaggcgtaa

DBGET integrated database retrieval system