KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1582Help
Entry
NMB1582           CDS       T00027                                 

Gene name
hisC
Definition
(RefSeq) histidinol-phosphate aminotransferase
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00340  Histidine metabolism
nme00350  Tyrosine metabolism
nme00360  Phenylalanine metabolism
nme00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nme00401  Novobiocin biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
nme01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    NMB1582 (hisC)
   00350 Tyrosine metabolism
    NMB1582 (hisC)
   00360 Phenylalanine metabolism
    NMB1582 (hisC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMB1582 (hisC)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    NMB1582 (hisC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nme01007]
    NMB1582 (hisC)
Enzymes [BR:nme01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     NMB1582 (hisC)
Amino acid related enzymes [BR:nme01007]
 Aminotransferase (transaminase)
  Class II
   NMB1582 (hisC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Alliinase_C Aminotran_5
Motif
Other DBs
NCBI-GeneID: 904223
NCBI-ProteinID: NP_274588
UniProt: Q9JYH7
Position
1644443..1645540
Genome map
AA seq 365 aa AA seqDB search
MKSVRSFIRDDIQAMSAYQIADVPPGFAKLDSMESPVHPFAGHETLLQEWQARLAAAPIH
LYPNPSGSGLQEALRSAFDIPDCADIALGNGSDELIQFITMLTAKPGAAMLAAEPSFVMY
RHNAALYGMDYVGVPLNGDFTLNLPAVLEAVRKHRPALTFIAYPNNPTGVCFTRAEIEAV
IEASDGIVVVDEAYGAFNGDSFLPQAGRIPNLIVLRTLSKIGFAGLRIGYAAGCPEVIGE
LQKILPPYNMNQLSLTTAKLALRHYGIISANIDSLKNERERMFAELGKICRLNTFSSQAN
FITIRVPDADLLFDTLKQNRILVKKLHGAHPLLEHCLRITVGSPAQNDAVLNIIRQLYCQ
PTDFL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccgtccgctccttcatccgcgacgacatacaagctatgtcggcatatcagatt
gccgacgttccgcccggctttgccaaactcgattcgatggaaagtcccgtccaccctttt
gccggacatgaaacgctgttgcaggaatggcaggcacggcttgccgccgcgcccatccat
ctttaccccaatccctccggcagcggtttacaggaagcattacgttcggcgttcgacatt
cccgactgcgccgacatcgcgctgggcaacggttcggacgaactgatacagttcatcacg
atgctgaccgccaaaccgggcgcggcaatgttggcagccgaacccagtttcgtcatgtac
cgccacaacgccgcgctgtacggcatggattatgtcggcgttccactgaacggagatttc
accctcaacctgcccgccgtcctcgaagccgtcaggaaacaccgccctgccctgaccttt
atcgcctaccccaacaaccccaccggcgtatgcttcacgcgtgccgaaatcgaagccgtc
atcgaagcttcagacggcatcgtcgtcgtcgatgaagcctacggcgcattcaacggcgac
agcttcctgccgcaggcaggcaggattcccaacctgatagtcttacgcaccctcagcaaa
atcggttttgccggactgcgtatcggttatgcggcaggctgccccgaagtcatcggcgaa
ctgcaaaaaatcctgccgccctacaatatgaaccaattgagcctgaccactgccaaactc
gccctgcggcactacggcattatctctgccaacatcgacagcctgaaaaacgaacgcgaa
cggatgttcgccgaattgggcaaaatatgccgtctgaacaccttttcaagtcaggcaaac
ttcattaccatacgcgtacccgatgccgatttgttgtttgacacgctcaaacaaaaccgc
atcttggttaaaaaactgcatggcgcgcacccgcttttggaacactgcctgcgcattacc
gtaggcagccccgcacaaaacgatgccgttctcaacatcattcgccaactttactgccaa
ccaacggatttcctatga

DBGET integrated database retrieval system