KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1583Help
Entry
NMB1583           CDS       T00027                                 

Gene name
hisB
Definition
(RefSeq) imidazoleglycerol-phosphate dehydratase
  KO
K01693  imidazoleglycerol-phosphate dehydratase [EC:4.2.1.19]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00340  Histidine metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    NMB1583 (hisB)
Enzymes [BR:nme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.19  imidazoleglycerol-phosphate dehydratase
     NMB1583 (hisB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPD
Motif
Other DBs
NCBI-GeneID: 904235
NCBI-ProteinID: NP_274589
UniProt: P64371
Position
1645720..1646454
Genome map
AA seq 244 aa AA seqDB search
MAKLEKHTGKPKGWLDRKHRERTVPETAAESTGTAETQIAETASAAGCRSVTVNRNTCET
QITVSINLDGSGKSRLDTGVPFLEHMIDQIARHGMIDIDISCKGDLHIDDHHTAEDIGIT
LGQAIRQALGDKKGIRRYGHSYVPLDEALSRVVIDLSGRPGLVYNIEFTRALIGRFDVDL
FEEFFHGIVNHSMMTLHIDNLSGKNAHHQAETVFKAFGRALRMAVEHDPRMAGQTPSTKG
TLTA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactcgaaaaacacaccggcaaacccaaaggctggctcgacagaaaacaccgc
gaacgcactgtccccgaaaccgccgcagaaagcaccggaactgccgaaacccaaattgcc
gaaaccgcatctgctgccggctgccgcagcgttaccgtcaaccgcaatacctgcgaaacc
caaatcaccgtctccatcaacctcgacggcagcggcaaaagcaggctggataccggcgta
cccttcctcgaacacatgatcgatcaaatcgcccgccacggcatgattgacatcgacatc
agctgcaaaggcgacctgcacatcgacgaccaccacaccgccgaagacatcggcatcaca
ctcggacaagcaatccggcaggcactcggcgacaaaaaaggcatccgccgttacggacat
tcctacgtcccgctcgacgaagccctcagccgcgtcgtcatcgacctttccggccgcccc
ggactcgtgtacaacatcgaatttacccgcgcactaatcggacgtttcgatgtcgatttg
tttgaagaatttttccacggcatcgtcaaccacagtatgatgaccctgcacatcgacaac
ctcagcggcaaaaacgcccaccatcaggcggaaaccgtattcaaagccttcgggcgcgcc
ctgcgtatggcagtcgaacacgacccgcgcatggcaggacagaccccctcgaccaaaggc
acgctgaccgcataa

DBGET integrated database retrieval system