KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1604Help
Entry
NMB1604           CDS       T00027                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00010  Glycolysis / Gluconeogenesis
nme00260  Glycine, serine and threonine metabolism
nme00680  Methane metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
nme01230  Biosynthesis of amino acids
Module
nme_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMB1604 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    NMB1604 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMB1604 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nme04131]
    NMB1604 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nme04147]
    NMB1604 (gpmA)
Enzymes [BR:nme01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     NMB1604 (gpmA)
Membrane trafficking [BR:nme04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    NMB1604 (gpmA)
Exosome [BR:nme04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   NMB1604 (gpmA)
  Exosomal proteins of melanoma cells
   NMB1604 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 904297
NCBI-ProteinID: NP_274610
UniProt: Q9JYF7
Position
complement(1664344..1665027)
Genome map
AA seq 227 aa AA seqDB search
MELVFIRHGQSEWNAKNLFTGWRDVKLSEQGLAEAAAAGKKLKENGYEFDIAFTSVLTRA
IKTCNIVLEESDQLFVPQIKTWRLNERHYGQLQGLDKKQTAEQYGDEQVRIWRRSYDTLP
PLLDKDDEFSAHKDRRYAHLPADVVPDGENLKVTLERVLPFWEDQIAPAILSGKRVLVAA
HGNSLRALAKHIEGISDEDIMGLEIPTGQPLVYKLDDNLKVIEKFYL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggaactggtatttatccgccacggacaaagcgaatggaacgcgaaaaacctgtttaca
ggctggcgcgacgtgaagctgagcgagcaggggcttgccgaggctgccgccgccggcaag
aaactgaaagaaaacggctatgagttcgacatcgccttcacatccgtcctgacccgcgcg
attaagacctgcaacatcgttttggaagaatccgaccaactgttcgtaccgcaaatcaaa
acgtggcggctgaacgaacgccactacggccaactgcaaggcctggacaaaaaacaaacc
gccgaacaatacggcgacgagcaagtccgcatctggcggcgcagctacgacaccctgccg
ccgcttttggacaaagacgatgagttttccgcacacaaagaccgccgctatgcccatctg
cctgccgatgtcgtacccgacggcgaaaacctgaaagtaacgctggagcgcgtattgccg
ttttgggaagaccaaatcgcccccgcgattttgagcggcaaacgcgtcttggtggcggcg
cacggcaactccctgcgcgcgctggcaaaacacatcgagggcatttccgacgaagacatt
atgggcttggaaatcccgaccggtcagccgttggtgtacaaattggacgacaatttgaaa
gtcatcgaaaaattctacctgtaa

DBGET integrated database retrieval system