KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1609Help
Entry
NMB1609           CDS       T00027                                 

Definition
(RefSeq) O-succinylhomoserine sulfhydrolase
  KO
K10764  O-succinylhomoserine sulfhydrylase [EC:2.5.1.-]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00270  Cysteine and methionine metabolism
nme00920  Sulfur metabolism
nme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    NMB1609
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NMB1609
Enzymes [BR:nme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.-  
     NMB1609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Beta_elim_lyase GDC-P Met_gamma_lyase SelA
Motif
Other DBs
NCBI-GeneID: 904307
NCBI-ProteinID: NP_274615
UniProt: Q9JYF3
Position
complement(1671729..1672898)
Genome map
AA seq 389 aa AA seqDB search
MSKKLHPQTLAIRGGKEQTEYREHNQALFLTSSFMWDNAQHAADLFSKKIKGFTYTRTAN
PTTAAFEKRIAALEGAERAVATSAGMSAIQAAFFTFLQAGDHVISSRSLFGTTVGFINNI
VAKFGIEVSHVSPTDINEWKAAVKANTKLLFLETPSNPLGEVADLEALAELAHGIGALLV
VDNSLLSPVGSQPLKHGADISVSSATKAIDGHGRVMGGVLAGSEELLAQVAMYCNSCGLA
MSPFNAWQLLSGVETLSLRMEKQFDNALKIAQWLQAQPQVQAVYYTGLSDHPQAALIRKQ
QNGGGIVIGFEVADQEAAWKVVDGVELFSRTANLGDVRSTITHPWTTTHGRMQPEEKLAA
NIRPGLVRLSVGLEYVGDLIDDLKQALAR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaactccatccgcaaacgctcgccatacgcggcggcaaagaacaaaccgaa
taccgcgaacacaatcaggcattgtttctgaccagcagcttcatgtgggacaacgcccaa
cacgctgccgatttgttttcaaaaaaaatcaaagggttcacttatacccgtaccgccaac
ccgaccacagccgcctttgaaaaacgcatcgccgctttggaaggtgcggaacgcgcggtc
gccacttcggcgggtatgtctgcgattcaggcggcgtttttcacctttttgcaggcgggc
gaccatgtgatttccagccgcagcctgttcggcacgaccgtcggctttatcaataacatc
gttgccaaattcggcatcgaagtgagccacgtgtcgccgactgatataaacgaatggaaa
gccgccgtcaaagccaataccaaactgctgtttttggaaacgccgtccaaccccttaggc
gaagtggccgacttggaagccttggcggaattggcgcacggcatcggcgcgctcttggtg
gtggacaacagcctgctgtcgcccgtcggctcgcagcctttgaaacacggtgcggatatt
tccgtttcctccgcgaccaaagccatagacggacacgggcgtgtgatgggcggcgtgttg
gcgggttcggaagagttgttggcgcaggtcgccatgtattgcaactcttgcgggctggcg
atgtcgccgtttaatgcgtggcagttgttgagcggcgtggaaaccctgtcgctgcgtatg
gaaaaacagttcgacaacgccctgaaaatcgcacaatggctgcaagcgcagccgcaggtt
caagccgtgtactacaccggattgtccgaccatcctcaggcggcgcttatccgcaaacag
caaaacggcggcggcatcgtcatcggctttgaagttgccgatcaagaagcggcgtggaaa
gttgtggacggcgtggaactcttttcccgcaccgccaacctcggtgacgtgcgctcgacc
attacccacccgtggacaaccacgcacggcaggatgcagcccgaagaaaaactcgccgcc
aacatccgccccggattggtgcgcctgtcggtcggtttggaatatgttggcgatttgatt
gacgatttgaaacaggcactcgcacgctga

DBGET integrated database retrieval system