KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1620Help
Entry
NMB1620           CDS       T00027                                 

Definition
(RefSeq) hypothetical protein
  KO
K01297  muramoyltetrapeptide carboxypeptidase [EC:3.4.17.13]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:nme01002]
    NMB1620
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nme01011]
    NMB1620
Enzymes [BR:nme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.13  muramoyltetrapeptide carboxypeptidase
     NMB1620
Peptidases [BR:nme01002]
 Serine Peptidases
  Family S66
   NMB1620
Peptidoglycan biosynthesis and degradation proteins [BR:nme01011]
 Precursor biosynthesis
  Carboxypeptidase
   NMB1620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S66 TAT_signal UCR_Fe-S_N
Motif
Other DBs
NCBI-GeneID: 904061
NCBI-ProteinID: NP_274626
UniProt: Q9JYE3
Position
1683371..1684555
Genome map
AA seq 394 aa AA seqDB search
MTEPTSRRRFLKTCTAAAGAGLLQACGTSATSVPPLPSSHSVVKARTVPLQTPRRQSSDG
NLLRVVASSGFAEDTNRVNTALTRLYNVGFTVTNQQAGSRRFQRFAGTDTQRAADFQEVA
SGRVATPKVLMGLRGGYGAARILPHIDFASLGARMREHGTLFFGFSDVCAVQLALLAKGN
MMSFAGPMAYSDFGKPAPGAFTMDAFIKGATQNRLTVDVPYIQRADVETEGILWGGNLSV
LASLAGTPYMPDIDGGILFLEDVGEQPYRIERMLNTLYLSGILKKQRAIVFGNFRMEKIR
DVYDPSYDFSAVANHVSRTAKIPVLTGFPFGHIADKITFPLGAHARIRMNGNSGYSVAFE
GYPTLDASALTLDTLLPPPDLPIFPESGVADISE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaccgacctcccgccgccgttttctgaaaacctgcaccgccgctgccggcgcg
gggctgcttcaggcttgcggcacatccgccacatccgttccgccccttccctcttcccat
tccgttgtgaaagcccgaaccgtgcctctccaaacgccacgccgtcaaagttcggacggc
aaccttctgcgcgttgtcgcttcgtcaggatttgccgaagacaccaaccgcgtcaacaca
gccttaacccgcctttacaatgtcggttttaccgtaaccaaccaacaggcgggcagccgc
cgtttccaacggtttgccggcacggacacgcaacgtgccgccgatttccaagaggtcgct
tccggccgcgtcgccacgcctaaagtgctgatgggtttgcgcggcggttacggtgcggcg
cggattctgccgcatatcgattttgcttcgctcggcgcaaggatgcgcgaacacggcacg
ctctttttcggattcagcgacgtatgcgccgtccagctggcattgttggcaaaaggcaat
atgatgagttttgccggcccgatggcttatagcgattttggcaaacccgcccccggtgcg
tttacgatggatgcctttatcaagggtgcaacccaaaaccgcctgaccgttgatgttcct
tatatccaacgcgccgatgtcgaaaccgaaggcatattgtggggcggcaacttaagcgtc
ctcgcctcgctcgccggcacgccttatatgcccgacatcgacggcggcattttgttcctc
gaagatgtcggcgaacagccctaccgcatcgaacgtatgctcaatacgctgtatctttcg
ggtattttgaagaaacagcgcgccatcgtgttcggcaatttccgtatggaaaaaattcga
gatgtctatgatccgtcttatgatttttctgccgttgccaaccatgtttcgcgcacggcg
aaaatccccgtgctgacgggcttcccgttcggacacattgccgacaaaatcactttccct
ctaggcgcgcacgcccgaatccgtatgaacggaaacagcggttattcggtcgcgtttgaa
ggctaccccacactcgatgcgtccgccctgactttggataccctgctcccaccgccggat
ttgcccatcttccccgaaagcggtgttgccgatatttcggaataa

DBGET integrated database retrieval system