KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1640Help
Entry
NMB1640           CDS       T00027                                 

Gene name
serC
Definition
(RefSeq) 3-phosphoserine/phosphohydroxythreonine aminotransferase
  KO
K00831  phosphoserine aminotransferase [EC:2.6.1.52]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00260  Glycine, serine and threonine metabolism
nme00680  Methane metabolism
nme00750  Vitamin B6 metabolism
nme01100  Metabolic pathways
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
nme01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    NMB1640 (serC)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMB1640 (serC)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NMB1640 (serC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nme01007]
    NMB1640 (serC)
Enzymes [BR:nme01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.52  phosphoserine transaminase
     NMB1640 (serC)
Amino acid related enzymes [BR:nme01007]
 Aminotransferase (transaminase)
  Class V
   NMB1640 (serC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-GeneID: 903939
NCBI-ProteinID: NP_274645
UniProt: P57007
Position
complement(1703959..1705065)
Genome map
AA seq 368 aa AA seqDB search
MSLYPIYNFSAGPAVLPEAVLETARQEMLDYNGTGFPVMAMSHRSEMFLSILHHAEQDLR
QLLKVPDNYKILFLQGGATTQFNMAAMNLAHGFRTADAVVTGNWSRIAYEQMSRLTDTEI
RLAAHGGEQFDYLDLPPVETWDVAPDSAFVHFAVNETVNGLQYREVPCLSEGMPPLVCDM
SSEILSREFDVADYGLIYAGAQKNIGPAGVTVVIVREDLLERCPNDIPDVFNYRSHINRD
GMYNTPSTYAIYMSGLVFRWLQAQGGVKKIEAVNRLKAQTLYETIDGSDGFYINRIRPNA
RSKMNVVFQTGDEELDRRFVLEAELQGLCLLKGYKTVGGMRASIYNAMPLEGVRALADFM
RDFQRRYG
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttatccgatttacaatttttccgccggccctgccgtattgcccgaagccgtg
ttggaaacggcgcggcaggaaatgttggactacaacggtacgggttttcctgtgatggca
atgagccaccgttcggaaatgtttttgagcatcctgcatcatgcggaacaggatttgagg
cagcttttgaaagtgcctgacaactataagatattgtttctgcagggcggagcaacaacc
caatttaatatggcagccatgaatctggcacacggtttccgcactgccgacgcggtggta
acgggcaactggagccgtatcgcttatgaacagatgagccgtttgaccgatacggaaatc
cgtttggcggcgcatggcggcgagcagttcgactatctcgacctgccgcctgtggaaacg
tgggatgttgcacccgattcggcgtttgtccattttgccgtcaatgaaacggtcaacggg
ctgcaataccgtgaagtgccgtgcctttcagaaggcatgccgccgctggtgtgcgatatg
tccagcgagattttgtcgcgcgagtttgatgttgccgactacggactgatttacgcaggc
gcacagaaaaacatcgggccggcaggagttacggtggtgattgtgcgtgaggatttgctc
gagcgttgtccgaacgatattcccgatgtgttcaactaccgttcgcacatcaaccgcgac
ggtatgtacaacacgccgtcaacttacgcgatttatatgtcggggctggtgttccgctgg
ctacaggcgcagggcggtgtgaaaaaaattgaagcggtcaatcggctgaaggcgcaaacc
ttgtatgagacgatagacggcagcgatggtttttatatcaaccgtatccgtccgaatgcg
cgttctaaaatgaatgtcgtgttccaaacgggggatgaggagcttgaccgccgttttgtg
ctggaagccgaattgcagggcttgtgcctgcttaagggctataaaaccgtcggcggtatg
cgtgccagcatttataatgcgatgccgcttgaaggcgtgcgggctttggcagattttatg
cgcgatttccaacggcgttacggttga

DBGET integrated database retrieval system