KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1647Help
Entry
NMB1647           CDS       T00027                                 

Definition
(RefSeq) amino acid symporter
  KO
K03310  alanine or glycine:cation symporter, AGCS family
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nme00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    NMB1647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_Ala_symp
Motif
Other DBs
NCBI-GeneID: 903469
NCBI-ProteinID: NP_274652
UniProt: Q9JYC8
Position
complement(1714040..1715458)
Genome map
AA seq 472 aa AA seqDB search
MENILSVLVGTVNRFLWDYLLIYALLGIGLFFTLYLGAPQITKLGAGFKSVFGGLFAKGD
KDDKSLSQFQALAVAISAQIGTGNVAGVATAITAGGPGAIFWMWVSAVLGMSTIFAEALL
AQKYRVVSHGKYIGGPAFYITHGLTPKIGRGAARFLSGFFSIALIIALGFIGNATQANSI
ASAVTIAFDVPSLAVGIVLAVLAGMVVIGGVNRIANIAQFVVPFMAVVYILCAVVILFEF
SDHIVPMFNHIFTAAFNPEAVLGGAAGIGMREAIRFGVARGLFSNEAGMGSTPHAHATAD
VKHPVQQGMAAFVGVFIDTILVCTATALIILLTDANLSGEQGAAVTQFAFNKAFPGFGSQ
LLAVCLTFFAFTTIIGWYYFGESNIRFLFRGRHLGIYRALVLLAIVLGTLGKVDLVWSLS
DMFNGFMVIPNLIALFLLRKEIRAIYDDYLAQKKAGRDLSYQYEFHEFHDKG
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatatattgtctgttctggtgggtacagtcaatcggttcctttgggactacctg
ctgatttacgcgcttttgggtatcggcctgttttttacgctgtatcttggtgcgccgcag
attaccaagctgggcgcgggattcaaatccgtattcggcggcttgtttgccaaaggcgat
aaagacgacaagtctttatcgcagtttcaggcgttggcggttgccatatctgcgcaaatc
ggtacgggcaacgttgccggcgtggcgaccgccatcaccgcaggcgggccgggcgcgatt
ttttggatgtgggtttctgccgttttggggatgtccacgatttttgcggaggcactgctg
gcgcagaaataccgcgtcgtcagccacggcaaatacatcggcgggccggcgttctacatc
acccacggtctgactccgaaaatcggcaggggcgcggcgcgttttttgtccggtttcttt
tccattgcgttgattatcgcattgggctttatcggtaatgcgacacaggcaaactccatt
gcttctgccgttaccattgcatttgatgtgccttctttggcagtcggtattgtgcttgcc
gtccttgcgggcatggttgtgattggcggcgtgaaccgtattgccaatatcgcccaattt
gtcgtgccgtttatggcggttgtttatattttgtgcgccgtcgttatcctgtttgaattt
tccgaccatattgtgccgatgttcaaccacatctttaccgccgccttcaatcccgaagcc
gttttgggcggtgctgcgggtatcggtatgcgcgaagcgatacgtttcggcgtggcgcgc
ggtctgttttccaacgaagcaggtatgggttcgactccgcacgcccacgcgactgcggat
gtgaagcaccctgtgcagcaaggtatggcggcatttgtcggtgtgtttatcgatacgatt
ttggtatgtacggctacggcattgattatcctgctgaccgatgccaacctttcgggcgaa
cagggcgcggcggttactcaatttgcctttaacaaggcatttccgggcttcggttcgcaa
ttgcttgccgtgtgtctgaccttctttgccttcaccaccatcatcggttggtattatttc
ggcgagtccaatatccgttttcttttcaggggaagacacttgggcatctatcgcgcattg
gttctgcttgccattgttttgggtacgctcggcaaagtcgatttggtttggagtctgtcg
gatatgttcaacggttttatggttatccccaacctgatagccctgtttttgttgcgtaag
gaaatccgcgccatttatgatgattatttggcacagaaaaaagcgggtcgggatttgtcc
tatcagtatgaattccacgagttccacgacaagggctga

DBGET integrated database retrieval system