KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1661Help
Entry
NMB1661           CDS       T00027                                 

Gene name
gmk
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00230  Purine metabolism
nme01100  Metabolic pathways
Module
nme_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NMB1661 (gmk)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     NMB1661 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_33 AAA_22 cobW MobB AAA_25 AAA_18 CbiA AAA_28 NTPase_1 CW_7 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 903450
NCBI-ProteinID: NP_274666
UniProt: Q9JYB5
Position
complement(1734867..1735484)
Genome map
AA seq 205 aa AA seqDB search
MSAYRKGNIFIISAASGTGKTTLVSRLLANHNGLRVSVSHTTRPPREGEANGVHYHFVSK
EEFESLIAQEAFLEYADVFGNYYGTGAEGVNALAAAGYDVILEIDVQGAAQVRDALPEAV
GIFILPPSFDVLAARLNGRGTDSREVIQRRLSKARHEIEQSVLFDFVVVNDDLARAEEDL
RHIVNACRLKRSRQLGFIADLLENS
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcttatcgaaaaggcaacatctttatcatttcggccgcttccggcacgggcaaa
accacgctggtgtcgcggctgttggcaaaccataacggtttgcgcgtttccgtgtcgcac
acgacgcgcccgccgcgtgaaggcgaagcaaacggcgtacattatcactttgtttccaaa
gaagagtttgagtcgcttatcgcgcaggaagcttttttggaatacgccgacgtatttggc
aactattacggcacaggcgcggagggtgtgaatgcgttggcggcggcaggctatgacgtg
attttggaaatcgacgttcagggcgcggcgcaggttcgcgacgcgctgcccgaagccgtc
ggcatctttatcctgccgccttctttcgacgtacttgccgcgcgcctcaacggacgcggg
acggacagtcgggaagttatccaaaggaggctgtcgaaggcaaggcatgaaatcgagcag
tccgtattgtttgactttgtcgtggtcaatgacgacttggcgcgagcggaggaggatttg
cgccatattgtgaatgcctgccgtctgaaaaggtcgcggcaactggggtttattgcagat
ttgttggaaaattcctag

DBGET integrated database retrieval system