KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1680Help
Entry
NMB1680           CDS       T00027                                 

Gene name
aroC
Definition
(RefSeq) chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
nme01230  Biosynthesis of amino acids
Module
nme_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMB1680 (aroC)
Enzymes [BR:nme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     NMB1680 (aroC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt
Motif
Other DBs
NCBI-GeneID: 903428
NCBI-ProteinID: NP_274684
UniProt: Q9JY99
Position
1756200..1757300
Genome map
AA seq 366 aa AA seqDB search
MAGNTFGQLFTVTTFGESHGAGLGCIIDGCPPGLELSEADIQFDLDRRKPGTSRHVTQRR
EADQVEILSGVFEGKTTGTPIALLIRNTDQRSKDYGNIATSFRPGHADYTYWHKYGTRDY
RGGGRSSARETAARVAAGAVAKKWLKEKFGTEITAYVTQVGEKEIRFEGCEHISQNPFFA
ANHSQIAELENYMDSVRKSLDSVGAKLHIEAANVPVGLGEPVFDRLDAEIAYAMMGINAV
KGVEIGAGFDSVTQRGSEHGDELTPQGFLSNHSGGILGGISTGQDIRVNIAIKPTSSIAT
PRRSIDINGNPIELATHGRHDPCVGLRSAPIAEAMLALVLIDHALRHRAQNADVQVNTPD
ITLSNK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcaacactttcggacaactcttcaccgttaccaccttcggcgaaagccacggc
gcgggtttgggctgtatcatcgacggctgcccgcccggcttggaattaagcgaagcggat
atccaatttgacctcgaccgacgcaaacccggcaccagccgccacgttacccaacgccgc
gaagccgaccaagtcgaaatcctctccggcgtattcgaaggcaaaaccaccggcacgccc
atcgccctcttaatccgcaataccgaccagcgcagcaaagactacggcaacatcgccacc
agcttccgccccggccacgccgactatacctattggcacaaatacggcacgcgcgactac
cgcggcggcggcaggagctccgcccgtgaaaccgccgcccgcgttgctgccggagccgtt
gccaaaaaatggttgaaagaaaaattcggcacggaaatcaccgcctacgttacccaagtc
ggcgaaaaagaaatccggtttgaaggctgcgaacacatttcccaaaatcctttttttgcc
gccaaccatagccaaattgccgagctggaaaactatatggacagcgtgcgcaaatccttg
gattccgtcggcgcgaagctgcatatcgaagcagccaatgtccctgtcggcttgggcgaa
cctgtttttgaccgcctcgatgccgaaatcgcctacgcgatgatgggcatcaacgccgtc
aaaggcgtggaaatcggcgcaggttttgacagcgtaacgcaacgcggcagcgaacacggc
gacgaactgaccccgcaaggcttcctgtccaaccactcaggcggcatcctcggcggcatc
agcaccgggcaagacatccgcgtcaatatcgccatcaaacccaccagctccatcgccacc
ccgcgccgcagtatcgacatcaacggcaaccccatcgaactcgccacgcacggcaggcac
gacccctgcgtcggactgcgctccgcgccgatcgccgaagccatgctcgcgttagtcctc
atcgaccacgccctgcgccatcgcgcgcaaaatgccgacgttcaggttaatacgcccgac
attaccctttcaaacaaataa

DBGET integrated database retrieval system