KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1688Help
Entry
NMB1688           CDS       T00027                                 

Gene name
ansA
Definition
(RefSeq) L-asparaginase
  KO
K01424  L-asparaginase [EC:3.5.1.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00250  Alanine, aspartate and glutamate metabolism
nme00460  Cyanoamino acid metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMB1688 (ansA)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    NMB1688 (ansA)
Enzymes [BR:nme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     NMB1688 (ansA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asparaginase Methyltransf_33
Motif
Other DBs
NCBI-GeneID: 903419
NCBI-ProteinID: NP_274692
UniProt: Q9JY91
Position
complement(1765088..1766089)
Genome map
AA seq 333 aa AA seqDB search
MMSMKQKIFVLYTGGTIGMTQSSEGLRPDTALVSQALSPFSDGLDFEWHVCNPLIDSSSV
TLQHWRDWLDIIADKLPSCDGILILHGTDSMAYTANLLALALQGLGKPIVLTGSQWPYAA
ENSDAPRNLSTAVAAFSLKLKQTVIAFDGKLYPAVGSSKVSTETAAGFDNPHFGTLAEWD
ETRGWHNLRLPSQDAAAVSDGLKIRYPDPQAKIAVRTLIPGFAVQELADGLGQLPAQALI
LQSYGHGNTPADEGFIRAVRDFARQGKLLLNISQVRQGKTAAVYAQGNAFRNSGIINGGK
CNLETATALMTLAVSQGWGKEDVYKELVRLKLV
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccatgaaacaaaaaatcttcgtcctctacacaggcggcaccataggcatgacc
caaagcagcgaaggcctgcgccccgataccgcactggttagccaagccctttcccccttt
tcagacggcctcgatttcgagtggcacgtctgcaatcccttgattgattcctcctccgtt
acgctgcaacactggcgcgattggctggacatcattgccgacaaactcccttcatgcgac
ggcatcctgatactgcacggcacggacagcatggcgtacaccgccaatctcctcgcgctc
gctctgcaaggtttgggcaaaccgattgtcctgactggttcccaatggccttacgccgcc
gaaaacagcgatgccccgcgcaacctctccaccgccgttgccgccttcagcctcaagctc
aaacaaaccgtcatcgcgtttgacggcaaactgtatcccgccgtcggcagcagcaaagtc
agcaccgaaactgctgcaggcttcgacaatccgcatttcggcacgcttgccgaatgggac
gaaacccggggttggcacaatcttcgcctcccgtcccaagacgcagcagccgtttcagac
ggcctcaaaatccgttatcccgacccgcaggcaaaaatcgctgtccgcacgcttatcccc
ggctttgccgtccaagaacttgcggacggactcggacagcttcccgcccaagctcttatc
ctgcaaagctacggacacggcaacacgcccgcagacgaaggttttatccgcgccgtccga
gacttcgcgcggcagggcaaactgctgctcaacatcagccaagtccgacaaggcaaaacc
gccgccgtttacgcgcaaggcaacgcgttccgcaactcgggcatcatcaacggcggcaaa
tgcaacctcgaaaccgccaccgcgctgatgaccctcgccgtatcgcaaggctggggtaag
gaagatgtttacaaagaattggtaagactaaagttagtgtga

DBGET integrated database retrieval system