KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1690Help
Entry
NMB1690           CDS       T00027                                 

Gene name
glmM
Definition
(RefSeq) phosphoglucosamine mutase
  KO
K03431  phosphoglucosamine mutase [EC:5.4.2.10]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00520  Amino sugar and nucleotide sugar metabolism
nme01100  Metabolic pathways
nme01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NMB1690 (glmM)
Enzymes [BR:nme01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.10  phosphoglucosamine mutase
     NMB1690 (glmM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-GeneID: 903417
NCBI-ProteinID: NP_274694
UniProt: Q9JY89
Position
complement(1767236..1768570)
Genome map
AA seq 444 aa AA seqDB search
MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDTDQKPTVLIGKDTRISGYML
EAALVAGFTAAGVNVVQTGPLPTPGVAYLTRALRLSAGVMISASHNAYSDNGIKFFAEGG
VKLSDEVELEIEAKIDGEMKTQPSARLGRARRISGADDRYIEFCKSTFPSHSDLRGLKLV
VDTANGAGYGVAPKVFHELGAQVVSIGNEPNGYNINEKCGATYTKTLQAAVLQHEADYGI
ALDGDGDRLMMVDKNGQVYDGDSLIYVIAKARAREGINIGGVVGTVMTNMAMEIALKEQG
VDFCRAKVGDRYVLEQLNQRGWLIGGEASGHILCMDKHNTGDGIISALQVLAALQTLNQD
LATVCADWQPYPQTMINVRIQKGQQWQEASKDVLAEVEKELEGKGRVVLRASGTEPVVRV
MVEARQADWAREGAERIAAAIGGI
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaaatatttcggcacggacggcgtgcgcggcgaagtggggcaatttccgatt
acgcccgatttcgtattgaaactcggctatgcggcggggcaggttttggtgcagcacgac
accgaccagaaaccgaccgtcctcatcggcaaagacacgcgcatttccggctatatgctg
gaagccgctttggtggccggttttacggcggcgggtgtgaatgtggtacagaccggaccg
ctgcccacgcccggcgtggcttatctgacccgcgcgttgcgcctgtccgccggcgtgatg
atttccgcgtcgcacaacgcctattccgacaacggcatcaaattcttcgccgaaggcggc
gtgaaactttccgatgaagtcgagttggaaatcgaagccaaaatcgacggcgaaatgaaa
acccaaccgtccgcccgtctcggtcgcgcacgccgcatcagcggtgcggacgaccgctat
atcgaattttgcaaatccacctttcccagccattccgaccttcggggtttgaagttggtt
gtcgataccgccaacggcgcggggtacggtgtcgcccccaaggtgtttcacgaactgggc
gcacaggtcgtcagcatcggcaacgaacccaacggctacaacatcaacgaaaaatgcggt
gcgacttataccaagacactccaggccgccgttttacagcatgaagccgactacggcatc
gccttagacggcgacggcgaccgcctgatgatggtcgataaaaacgggcaggtttacgac
ggcgacagcctgatttacgtcattgccaaagcccgcgcccgagaaggtatcaacatcggc
ggcgtggtcggcacggtcatgaccaatatggcgatggaaatcgccctgaaagagcagggc
gtggatttctgccgcgccaaagtcggcgaccgctatgtgttggaacagctgaaccaacgc
ggctggctcatcggcggcgaagccagcggccatattttgtgtatggacaaacacaacacc
ggcgacggcattatttccgcgctgcaagttttggcggcactgcaaacgctgaaccaagac
ctcgccaccgtttgcgccgattggcagccgtatccgcaaacgatgattaacgtgcgcatc
caaaaaggtcagcaatggcaggaagcttcgaaagacgtgttggcggaagtggaaaaagaa
ctcgaaggcaaagggcgtgtcgtgttgcgcgcttcgggaaccgaacccgtcgtgcgcgtg
atggtggaggcgcggcaggcggattgggcgcgcgaaggggcggaacgcattgccgccgcc
atcggcggcatttag

DBGET integrated database retrieval system