KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1691Help
Entry
NMB1691           CDS       T00027                                 

Gene name
folP
Definition
(RefSeq) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00790  Folate biosynthesis
nme01100  Metabolic pathways
Module
nme_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NMB1691 (folP)
Enzymes [BR:nme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     NMB1691 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-GeneID: 903415
NCBI-ProteinID: NP_274695
UniProt: Q51161
Position
complement(1768700..1769557)
Genome map
AA seq 285 aa AA seqDB search
MARHVWQAGRFEIGLDKPKIMGIVNLTPDSFSDGGVYSQNAQTALAHAEQLLKEGADILD
IGGESTRSGADYVSPEEEWARVEPVLAEVAGWGVPISLDTRRTVIMEKALALGGIDIIND
VAALNDEGAVELLARQADTGICLMHMQGLPKTMQINPKYQDVVGEVARYLKARSAECIAA
GIAPQRIILDPGFGSGFGKPLQHNIALMRHLPELMAETGFPLLIGVSRKSTIGELTGEAN
AAERVHGSVAAALASVARGAQIVRVHDVKATADALKVWEALGINL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcacgacacgtttggcaggcaggacggtttgaaatcggtttggacaaaccgaaaatc
atgggcatcgtgaatctcacacccgattctttttccgacggcggcgtgtattcgcaaaac
gcccaaacagccttggcacatgccgaacagcttctaaaagaaggcgcagacattctcgac
atcggcggcgaatcgacgcggtcgggtgcggattatgtttcgcctgaagaagaatgggcg
cgggttgagcctgttttggcggaagtggcggggtggggcgttcccatcagtttggacacg
cgccgcacggtgattatggaaaaagcgttggcactcggcggcatcgatattattaatgat
gtggcggcgttgaatgacgagggcgcggtcgaattgctggcgcgtcaggcggacacgggc
atttgcctgatgcacatgcagggtttgcccaaaaccatgcagattaatccgaaatatcaa
gatgttgtcggtgaagtagcgcggtatttgaaagcgcgctcagcggaatgtatcgcggca
ggcatcgcaccgcaacgcatcatactcgaccccggcttcggctccggcttcggcaaaccc
ttgcaacacaatatcgcgctgatgcggcatttgcccgaattgatggcggaaacaggtttt
ccgctgctcatcggcgtatcgcgcaaaagcacgataggcgagctgaccggcgaggcaaat
gcggcggaacgcgtacacggcagcgtggcggcagcgttggcttccgtagcgcgcggcgcg
caaatcgtgcgggtgcatgatgtgaaggcgacagcggatgcgttgaaggtgtgggaagcg
ttgggcatcaatctgtaa

DBGET integrated database retrieval system