KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1705Help
Entry
NMB1705           CDS       T00027                                 

Gene name
rfaK
Definition
(RefSeq) alpha 1,2 N-acetylglucosamine transferase
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_1_2
Motif
Other DBs
NCBI-GeneID: 903397
NCBI-ProteinID: NP_274709
UniProt: Q9JY75
Position
1781264..1782328
Genome map
AA seq 354 aa AA seqDB search
MEKEFRILNIVSAKIWGGGEQYVYDVSKALGLRGCTMFTAVNKNNELMHRRFSEVSSVFT
TRLHTLNGLFSLYALTRFIRKNRISHLMIHTGKIAALSILLKKLTGVRLIFVKHNVVANK
TDFYHRLIQKNTDRFICVSRLVYDVQTADNPFKEKYRIVHNGIDTGRFPPSQEKPDSRFF
TVAYAGRISPEKGLENLIEACVILHRKYPQIRLKLAGDGHPDYMCRLKRDVSASGAEPFV
SFEGFTEKLASFYRQSDVVVLPSLVPEAFGLSLCEAMYCRTAVISNTLGAQKEIVEHHQS
GILLDRLTPESLADEIERLVLNPETKNALATAAHQCVAARFTINHTADKLLDAI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagaattcaggatattaaatatcgtatcggccaagatttggggtggaggcgaa
caatatgtctatgatgtttcaaaagcattggggcttcggggctgcacaatgtttaccgcc
gtcaataaaaataatgaattgatgcacaggcgattttccgaagtttcttccgttttcaca
acgcgccttcacacgctcaacgggctgttttcgctctacgcacttacccgctttatccgg
aaaaaccgcatttcccacctgatgatacacaccggcaaaattgccgccttatccatactt
ttgaaaaaactgaccggggtgcgcctgatatttgtcaaacataatgtcgtcgccaacaaa
accgatttttaccaccgcctgatacagaaaaacacagaccgctttatttgcgtttcccgt
ctggtttacgatgtgcaaaccgccgacaatccctttaaagaaaaataccggattgttcat
aacggtatcgataccggccgtttccctccctctcaagaaaaacccgacagccgttttttt
accgtcgcctacgccggcaggatcagtccagaaaaaggattggaaaacctgattgaagcc
tgtgtgatactgcatcggaaatatcctcaaatcaggctcaaattggcaggggacggacat
ccggattatatgtgccgcctgaagcgggacgtatctgcttcaggagcagaaccatttgtt
tcttttgaagggtttaccgaaaaacttgcttcgttttaccgccaaagcgatgtcgtggtt
ttgcccagcctcgtcccggaggcattcggtttgtcattatgcgaggcgatgtactgccga
acggcggtgatttccaatactttgggggcgcaaaaggaaattgtcgaacatcatcaatcg
gggattctgctggacaggctgacacctgaatctttggcggacgaaatcgaacgcctcgtc
ttgaaccctgaaacgaaaaacgcactggcaacggcagctcatcaatgcgtcgccgcccgt
tttaccatcaaccataccgccgacaaattattggatgcaatataa

DBGET integrated database retrieval system