KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1710Help
Entry
NMB1710           CDS       T00027                                 

Gene name
gdhA
Definition
(RefSeq) glutamate dehydrogenase
  KO
K00262  glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00220  Arginine biosynthesis
nme00250  Alanine, aspartate and glutamate metabolism
nme00910  Nitrogen metabolism
nme01100  Metabolic pathways
nme01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    NMB1710 (gdhA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMB1710 (gdhA)
   00220 Arginine biosynthesis
    NMB1710 (gdhA)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.4  glutamate dehydrogenase (NADP+)
     NMB1710 (gdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ELFV_dehydrog ELFV_dehydrog_N NAD_binding_7 2-Hacid_dh_C XdhC_C FMO-like
Motif
Other DBs
NCBI-GeneID: 903392
NCBI-ProteinID: NP_274713
UniProt: Q9JY71
Position
1786070..1787404
Genome map
AA seq 444 aa AA seqDB search
MTDLNTLFANLKQRNPNQEPFHQAVEEVFMSLDPFLAKNPKYTQQSLLERIVEPERVVMF
RVTWQDDKGQVQVNRGYRVQMSSAIGPYKGGLRFHPTVDLGVLKFLAFEQVFKNALTTLP
MGGGKGGSDFDPKGKSDAEVMRFCQAFMTELYRHIGADTDVPAGDIGVGGREIGYLFGQY
KKIRNEFSSVLTGKGLEWGGSLIRPEATGYGCVYFAQAMLQTRNDSFEGKRVLISGSGNV
AQYAAEKAIQLGAKVLTVSDSNGFVLFPDSGMTEAQLAALIELKEVRRERVATYAKEQGL
QYFEKQKPWGVAAEIALPCATQNELDEEAAKTLLANGCYVVAEGANMPSTLGAVEQFIKA
GILYAPGKASNAGGVATSGLEMSQNAIRLSWTREEVDQRLFGIMQSIHESCLKYGKVGDT
VNYVNGANIAGFVKVADAMLAQGF
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgactgacctgaacaccctgtttgccaacctcaaacaacgcaatcccaatcaggagccg
ttccatcaggcggttgaagaagtcttcatgagtctcgatccgtttttggcaaaaaatccg
aaatacacccagcaaagcctgctggaacgcatcgtcgaacccgaacgcgtcgtgatgttc
cgcgtaacctggcaggacgataaagggcaagtccaagtcaaccggggctaccgcgtgcaa
atgagttccgccatcggtccttacaaaggcggcctgcgcttccatccgaccgtcgatttg
ggcgtattgaaattcctcgcttttgaacaagtgttcaaaaacgccttgaccaccctgcct
atgggcggcggcaaaggcggttccgacttcgaccccaaaggcaaatccgatgccgaagta
atgcgcttctgccaagcctttatgaccgaactctaccgccacatcggcgcggacaccgat
gttccggccggcgacatcggcgtaggcgggcgcgaaatcggctacctgttcggacaatac
aaaaaaatccgcaacgagttttcttccgtcctgaccggcaaaggtttggaatggggcggc
agcctcatccgtcccgaagcgaccggctacggctgcgtctatttcgcccaagcgatgctg
caaacccgcaacgatagttttgaaggcaaacgcgtcctgatttccggctccggcaatgtg
gcgcaatacgccgccgaaaaagccatccaactgggtgcgaaagtactgaccgtttccgac
tccaacggcttcgtcctcttccccgacagcggtatgaccgaagcgcaactcgccgccttg
atcgaattgaaagaagtccgccgcgaacgcgttgccacctacgccaaagagcaaggtctg
caatactttgaaaaacaaaaaccgtggggcgtcgccgccgaaatcgccctgccctgcgcg
acccagaacgaattggacgaagaagccgccaaaaccctgttggcaaacggctgctacgtc
gttgccgaaggtgcgaatatgccgtcgactttgggcgcggtcgagcaatttatcaaagcc
ggcatcctctacgccccgggaaaagcctccaatgccggcggcgtggcaacttcaggtttg
gaaatgagccaaaacgccatccgcctgtcttggactcgtgaagaagtcgaccaacgcctg
ttcggcatcatgcaaagcatccacgaatcctgtctgaaatacggcaaagtcggcgacaca
gtaaactacgtcaatggtgcgaacattgccggtttcgtcaaagttgccgatgcgatgctg
gcgcaaggcttctaa

DBGET integrated database retrieval system