KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1714Help
Entry
NMB1714           CDS       T00027                                 

Gene name
mtrE
Definition
(RefSeq) multidrug efflux pump channel protein
  KO
K18139  outer membrane protein, multidrug efflux system
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme01501  beta-Lactam resistance
nme02024  Quorum sensing
Module
nme_M00647  Multidrug resistance, efflux pump AcrAB-TolC/SmeDEF
Brite
KEGG Orthology (KO) [BR:nme00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    NMB1714 (mtrE)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01501 beta-Lactam resistance
    NMB1714 (mtrE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nme02000]
    NMB1714 (mtrE)
   01504 Antimicrobial resistance genes [BR:nme01504]
    NMB1714 (mtrE)
Transporters [BR:nme02000]
 Other Transporters
  Pores ion channels [TC:1]
   NMB1714 (mtrE)
Antimicrobial resistance genes [BR:nme01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexAB-OprM [MD:M00718]
    NMB1714 (mtrE)
   Multidrug resistance, efflux pump MexJK-OprM [MD:M00642]
    NMB1714 (mtrE)
   Multidrug resistance, efflux pump MexXY-OprM [MD:M00643]
    NMB1714 (mtrE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OEP CEP170_C
Motif
Other DBs
NCBI-GeneID: 903388
NCBI-ProteinID: NP_274717
UniProt: Q9JY68
Position
complement(1790509..1791912)
Genome map
AA seq 467 aa AA seqDB search
MDTTLKTTLTSVAAAFALSACTMIPQYEQPKVEVAETFKNDTADSGIRAVDLGWHDYFAD
PRLQKLIDIALERNTSLRTAVLNSEIYRKQYMIERNNLLPTLAANANDSRQGSLSGGNVS
SSYKVGLGAASYELDLFGRVRSSSEAALQGYFASTANRDAAHLSLIATVAKAYFNERYAE
EAMSLAQRVLKTREETYKLSELRYKAGVISAVALRQQEALIESAKADYAHAARSREQARN
ALATLINQPIPEDLPAGLPLDKQFFVEKLPAGLSSEVLLDRPDIRAAEHALKQANANIGA
ARAAFFPSIRLTGTVGTGSAELGGLFKSGTGVWSFAPSITLPIFTWGTNKANLDVAKLRQ
QVQIVAYESAVQSAFQDVANALAAREQLDKAYDALSKQSRASKEALRLVGLRYKHGVSGA
LDLLDAERSSYAAEGAALSAQLTRAENLADLYKALGGGLKRDTQTDK
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggatactacattgaaaaccaccttgacttctgttgcagcagcctttgcattgtctgcc
tgcaccatgattccccaatacgagcagcccaaagtcgaagttgccgaaacgttcaaaaac
gataccgccgacagcggcatccgcgccgtcgatttaggttggcatgactattttgccgac
ccgcgcctgcaaaagctgatcgacatcgcactcgagcgcaataccagtttgcgtaccgcc
gtattgaacagcgaaatctaccgcaaacaatacatgattgagcgcaacaacctcctgccc
acgcttgccgccaatgcgaacgactcgcgccaaggcagcttgagcggcggcaatgtaagc
agcagctacaaagtcggactgggtgcggcatcttacgaactcgatctgttcgggcgtgta
cgcagcagcagcgaggcggcactgcaaggctatttcgccagcaccgccaaccgcgatgcg
gcacatttgagcctgattgccaccgttgccaaagcctatttcaacgaacgttacgccgaa
gaagcgatgtctttggcgcaacgtgttttgaaaacgcgcgaggaaacctacaagctgtcc
gaattacgttacaaggcaggcgtgatttccgccgtcgccctacgtcagcaggaagccctg
atcgaatctgccaaagccgattatgcccatgccgcgcgcagccgcgaacaggcgcgcaat
gccttggcaaccttgattaaccaaccgatacccgaagacctgcctgccggtttgccgctg
gacaagcagttttttgttgaaaaactgccggccggtttgagttccgaagtattgctcgac
cgtcccgatatccgtgctgccgaacacgcgctcaaacaggcaaacgccaatatcggtgcg
gcacgcgccgcctttttcccatccatccgcctgaccggaaccgtcggtacgggttctgcc
gaattgggtgggttgttcaaaagcggcacgggcgtttggtcgttcgcgccgtctattacc
ctgccgatttttacctggggtacgaacaaggcgaaccttgatgtagccaagctgcgccaa
caggtacaaatcgttgcctatgaatccgccgtccaatccgcatttcaagacgtggcaaac
gcattggcggcgcgcgagcagctggataaagcctatgacgctttaagcaaacaaagccgc
gcctctaaagaagcgttgcgcttggtcggcctgcgttacaagcacggcgtatccggcgcg
ctcgacttgctcgatgcggaacgcagcagctatgcggcggagggtgcggctttgtcggca
caactgacccgcgccgaaaaccttgccgatttgtacaaggcactcggcggcggattgaaa
cgggatacccaaaccgacaaataa

DBGET integrated database retrieval system