KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1719Help
Entry
NMB1719           CDS       T00027                                 

Gene name
mtrF
Definition
(RefSeq) efflux pump component MtrF
  KO
K12942  aminobenzoyl-glutamate transport protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nme00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99987 Cofactor metabolism
    NMB1719 (mtrF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABG_transport DcuC DUF4141
Motif
Other DBs
NCBI-GeneID: 903382
NCBI-ProteinID: NP_274722
UniProt: Q9JY63
Position
1798278..1799846
Genome map
AA seq 522 aa AA seqDB search
MSQTDTQRDGRFLRTVEWLGNMLPHPVTLFIIFIVLLLIASAVGAYFGLSVPDPRPVGAK
GRADDGLIYIVSLLNADGFIKILTHTVKNFTGFAPLGTVLVSLLGVGIAEKSGLISALMR
LLLTKSPRKLTTFMVVFTGILSNTASELGYVVLIPLSAIIFHSLGRHPLAGLAAAFAGVS
GGYSANLFLGTIDPLLAGITQQAAQIIHPDYVVGPEANWFFMVASTFVIALIGYFVTEKI
VEPQLGPYQSDLSQEEKDIRHSNEITPLEYKGLIWAGVVFVALSALLAWSIVPADGILRH
PETGLVSGSPFLKSIVVFIFLLFALPGIVYGRVTRSLRGEQEVVNAMAESMSTLGLYLVI
IFFAAQFVAFFNWTNIGQYIAVKGATFLKEVGLGGSVLFIGFILICAFINLMIGSASAQW
AVTAPIFVPMLMLAGYAPEVIQAAYRIGDSVTNIITPMMSYFGLIMATVIKYKKDAGVGT
LISMMLPYSAFFLIAWIALFCIWVFVLGLPVGPGAPTFYPAP
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaccgatacgcaacgggacggacgatttttacgcacagtcgaatggctgggc
aatatgttgccgcatccggttacgctttttattattttcattgtgttattgctgattgcc
tctgccgtcggtgcgtatttcggactatccgtccccgatccgcgccctgttggtgcgaaa
ggacgtgccgatgacggtttgatttacattgtcagcctgctcaatgccgacggttttatc
aaaatcctgacgcataccgttaaaaatttcaccggtttcgcgccgttgggaacggtgttg
gtttctttattgggcgtggggattgcggaaaaatcgggcttgatttccgcattaatgcgc
ttattgctcacaaaatcgccacgcaaactcactacttttatggttgtttttacagggatt
ttatctaataccgcttctgaattgggctatgtcgtcctaatccctttgtccgccatcatc
tttcattccctcggccgccatccgcttgccggtctggctgcggctttcgccggcgtttcg
ggcggttattcggccaatctgttcttaggcacaatcgatccgctcttggcaggcatcacc
caacaggcggcgcaaatcatccatcccgactacgtcgtaggccctgaagccaactggttt
tttatggtagccagtacgtttgtgattgctttgattggttattttgttactgaaaaaatc
gtcgaaccgcaattgggcccttatcaatcagatttgtcacaagaagaaaaagacattcgg
cattccaatgaaatcacgcctttggaatataaaggattaatttgggctggcgtggtgttt
gttgccttatccgccctattggcttggagcatcgtccctgccgacggtattttgcgtcat
cctgaaacaggattggtttccggttcgccgtttttaaaatcgattgttgtttttattttc
ttgttgtttgcactgccgggcattgtttatggccgggtaacccgaagtttgcgcggcgaa
caggaagtcgttaatgcgatggccgaatcgatgagtactctggggctttatttggtcatc
atcttttttgccgcacagtttgtcgcattttttaattggacgaatattgggcaatatatt
gccgttaaaggggcgacgttcttaaaagaagtcggcttgggcggcagcgtgttgtttatc
ggttttattttaatttgtgcttttatcaatctgatgataggctccgcctccgcgcaatgg
gcggtaactgcgccgattttcgtccctatgctgatgttggccggctacgcgcccgaagtc
attcaagccgcttaccgcatcggtgattccgttaccaatattattacgccgatgatgagt
tatttcgggctgattatggcgacggtgatcaaatacaaaaaagatgcgggcgtgggtacg
ctgatttctatgatgttgccgtattccgctttcttcttgattgcgtggattgccttattc
tgcatttgggtatttgttttgggcctgcccgtcggtcccggcgcgcccacattctatccc
gcaccttaa

DBGET integrated database retrieval system