KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1723Help
Entry
NMB1723           CDS       T00027                                 

Gene name
fixP
Definition
(RefSeq) cytochrome c oxidase subunit III
  KO
K00406  cytochrome c oxidase cbb3-type subunit III
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00190  Oxidative phosphorylation
nme01100  Metabolic pathways
nme02020  Two-component system
Module
nme_M00156  Cytochrome c oxidase, cbb3-type
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    NMB1723 (fixP)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NMB1723 (fixP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrome_CBB3 FixP_N Cytochrom_C DUF4131 MFS_1 DEC-1_N Ribosomal_L11_N
Motif
Other DBs
NCBI-GeneID: 903379
NCBI-ProteinID: NP_274726
UniProt: Q9JY60
Position
complement(1805070..1806167)
Genome map
AA seq 365 aa AA seqDB search
MNTTSQFTSNFWNIYIAVIVLLSFIALAWLLLSQNVVKRPKKGEEVQTTGHEWDGIAEYD
NPLPRWWFWLCVLTWLFGIGYLVMYPGVGDYKGLLKWTSHNQYEKEVKKADEQYGKLYAK
FADMPIEKVAKDPQAKQIAQNLFNTYCIQCHGSDAKGSKGFPNLTDSDWLWGGDPDKIHE
TIEKGRVATMPAWGPALGEEGVKDVAHYVMSLSKPEGQYDEERAARGQALFSGPPANCFT
CHGDKGQGIQGLGPNLTDDVWLWGGTQKSIIETITNGRSSQMPAWGHFLDKDKLHIMTAY
VWGLSDKDGKAPVKKAEPAPTPAPAAEPAASAPAEAAQAVSEAKPAAAEPKAEEKAAPAA
KADGK
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaacatcccaatttaccagtaatttctggaatatatatattgcagttattgtc
ttactgagctttatcgctttggcttggctgctgctgtctcaaaatgttgtcaaacgtccg
aagaagggcgaagaagtacaaactacgggtcatgagtgggacggcattgccgaatacgac
aatccgctgccccgctggtggttttggctgtgtgttttgacgtggctgttcggtatcggt
tatttggttatgtatccgggtgtcggcgactacaaaggtctgctgaaatggaccagccat
aaccaatatgaaaaagaggtcaaaaaagccgatgagcaatacggcaaactgtatgccaag
tttgcggatatgccgattgaaaaagtggcaaaagaccctcaagccaagcaaatcgcccaa
aacctgtttaacacttattgtatccagtgccacggctctgatgctaaaggctctaaaggt
tttccgaatctgaccgatagcgattggttgtggggcggtgatcccgataaaatccacgag
accatcgaaaaaggccgtgttgcgactatgcctgcctggggtcctgctttgggcgaagaa
ggcgtgaaagacgttgcccattatgtgatgtccctttcaaaacccgaaggtcagtatgat
gaggaacgtgccgcgcgcggacaagccttgttcagcggtccgcctgccaactgtttcact
tgccacggcgataagggacaaggtatccaaggtttgggtccgaacctgactgatgacgtg
tggttgtggggcggtacgcaaaaatccattatcgaaaccattaccaacggtcgcagcagc
caaatgcccgcttggggacatttcttggataaagacaaactgcatattatgactgcttat
gtatggggtctttccgataaagacggtaaagctccggtgaaaaaagccgagcctgcaccg
actcccgcaccggcggcagaacccgcagcctctgctcctgcagaagcagcacaagccgtg
tccgaagccaaacctgccgcagcagaacctaaagccgaggaaaaagctgcacctgctgcc
aaagcggacggcaaatag

DBGET integrated database retrieval system