KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1735Help
Entry
NMB1735           CDS       T00027                                 

Gene name
relA
Definition
(RefSeq) GTP pyrophosphokinase
  KO
K00951  GTP pyrophosphokinase [EC:2.7.6.5]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NMB1735 (relA)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     NMB1735 (relA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD_4 RelA_SpoT TGS ACT_4 ACT
Motif
Other DBs
NCBI-GeneID: 903364
NCBI-ProteinID: NP_274738
UniProt: Q9JY54
Position
1817604..1819817
Genome map
AA seq 737 aa AA seqDB search
MTAISPIQDTQSATLQELREWFDSYCAALPDNDKNLIGTAWLLAQEHYPADAATPYGEPL
PDHFLGAAQMVHELDLLPDAVAATLLADIGRYVPDWNLLVSERCNSTVAELVKGVDEVQK
LTHFARVDSLATPEERAQQAETMRKMLLAMVTDIRVVLIKLAMRTRTLQFLSNAPDSPEK
RAVAKETLDIFAPLANRLGVWQLKWQLEDLGFRHQKPEKYREIALLLDEKRTERLEYIEN
FLNILRGELKKYNVHFEVAGRPKHIYSIYKKMVKKKLSFDGLFDIRAVRILVDTVPECYT
TLGIVHSLWQPIPGEFDDYIANPKGNGYKSLHTVIVGPEDKGVEVQIRTFDMHQFNEFGV
AAHWRYKEGGKGDSAYEQKIAWLRQLLDWRENMAESGKEDLAAAFKTELFNDTIYVLTPH
GKVLSLPTGATPIDFAYALHSSIGDRCRGAKVEGQIVPLSTPLENGQRVEIITAKEGHPS
VNWLYEGWVKSNKAIGKIRAYIRQQNADTVREEGRVQLDKQLAKLTPKPNLQELAENLGY
KKPEDLYTAVGQGEISNRAIQKACGTLNEPPPVPVSETTIVKQSKIKKGGKNGVLIDGED
GLMTTLAKCCKPAPPDDIIGFVTRERGISVHRKTCPSFQHLAEHAPEKVLDASWAALQEG
QVFAVDIEIRAQDRSGLLRDVSDALARHKLNVTAVQTQSRDLEASMRFTLEVKQVNDLPR
VLASLGDVKGVLSVTRL
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccatcagcccgattcaagacacgcaaagcgcgactctgcaagaattgcgcgaa
tggttcgacagctactgcgccgctctgccggacaacgataaaaacctcatcggtaccgca
tggttgctggcgcaggaacattaccccgccgatgccgccacgccgtatggcgagccgctg
cccgaccacttcctcggcgcggcgcaaatggttcatgaactcgacctgctccccgatgcc
gtcgccgccaccctgcttgccgacatcggacgctacgtccccgactggaacctattggtt
tccgaacgctgcaacagtaccgtcgccgagctggtcaaaggtgtggacgaagtgcagaaa
ctcacccacttcgcccgggtggacagcctcgccacgccggaagaacgcgcccagcaggca
gaaactatgcggaaaatgctgctggcgatggttaccgacatccgcgtcgtgttaatcaaa
ctggcgatgcgtacgcgcaccctgcaatttttaagcaacgcccccgacagccccgaaaaa
cgcgccgtcgccaaagaaaccctcgacatcttcgccccgctcgccaaccgtttgggcgtg
tggcagctcaaatggcagctcgaagatttgggcttccgccatcaaaagcccgaaaaatac
cgcgaaatcgcgctgcttttggacgaaaaacgcaccgaacgcctcgaatacatcgaaaac
ttcctcaacatcctgcgcggtgaactcaagaaatacaatgtccatttcgaagtcgccggc
cgcccgaaacacatctactccatttacaaaaaaatggtgaagaaaaaactcagcttcgac
ggcctctttgacatccgcgccgtgcgaattctggttgataccgtccccgagtgttacacc
acgctgggtatcgtccacagcctctggcagcccattcccggcgagttcgacgactacatc
gccaatcccaaaggcaacggctataaaagtttgcacaccgtcatcgtcggcccggaagac
aaaggcgtggaagtacaaatccgcaccttcgatatgcaccaattcaacgaattcggtgtc
gccgcccactggcgttacaaagagggcggcaagggcgattccgcctacgaacagaaaatc
gcctggttgcgccaactcttggactggcgcgaaaacatggcggaaagcggcaaggaagac
ctcgccgccgccttcaaaaccgagcttttcaacgacacgatttatgttttgaccccgcac
ggcaaagtcctctccctgcccacgggcgcgacccccatcgacttcgcctacgccctgcac
agcagcatcggcgaccgttgccgcggtgcgaaagtcgaagggcagattgtgccgctgtcc
accccgctcgaaaacggacagcgcgtcgaaatcattaccgccaaagaagggcatccttcc
gtcaactggctttacgaaggctgggtcaaatccaacaaggcaatcggcaaaatccgcgcc
tacatccgccagcaaaacgccgacaccgtgcgcgaagaaggccgcgtccaactcgacaaa
cagcttgccaaactcacgcccaaacccaacctgcaagagcttgccgaaaatctcggctac
aaaaagccagaagacctctacaccgccgtcggacaaggcgaaatttccaaccgcgccatc
caaaaagcctgcggcacgctgaacgaaccgccgcccgtacccgtcagcgaaaccaccatc
gtcaaacagtccaaaatcaaaaaaggcggcaaaaacggcgtgctcatcgacggcgaagac
ggtctgatgaccacgcttgccaaatgctgcaaacccgcgccgcccgacgatattatcggc
ttcgttacccgcgagcgcggcatttcagtgcaccgcaaaacctgcccgtctttccaacac
ctcgccgaacacgcgcccgaaaaagtgctggacgcaagctgggcggcattgcaggaagga
caagtattcgccgtcgatatcgaaatccgcgcccaagaccgctccgggcttttgcgcgac
gtatccgacgcgctcgcccgccacaaactcaacgttaccgccgtgcaaacccagtcccgc
gacttggaagccagcatgaggttcacgctcgaagtcaaacaagtcaacgacctcccgcgc
gtcctcgccagcctcggcgacgtcaaaggcgtattgagcgttacccggctttaa

DBGET integrated database retrieval system