KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1787Help
Entry
NMB1787           CDS       T00027                                 

Gene name
argC
Definition
(RefSeq) N-acetyl-gamma-glutamyl-phosphate reductase
  KO
K00145  N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00220  Arginine biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
nme01210  2-Oxocarboxylic acid metabolism
nme01230  Biosynthesis of amino acids
Module
nme_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    NMB1787 (argC)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     NMB1787 (argC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dh Semialdhyde_dhC DapB_N NAD_binding_10 GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 903312
NCBI-ProteinID: NP_274786
UniProt: Q9JY18
Position
1874194..1875237
Genome map
AA seq 347 aa AA seqDB search
MSKKIKVGIVGATGYTGVELLRLLAAHPDVEVAAVTSRSEAGTAVADYFPSLRGVYGLAF
QTPDEAGLEQCDIVFFATPNGIAMKDAPRLIEQGVRVIDLSADFRIRDIPTWEHWYGMTH
AAPDLVSQAVYGLSELNREAVAQARLVANPGCYPTCVSLPLVPLLRQCRLKPGMPLIADC
KSGVSGAGRKGNVGSLLCEAGDNFKAYGIAGHRHLPEIRQTIAGLQDGIAEGFVFTPHLA
PMIRGMHATVYLHLSDGSDPETVLRDYYRDSPFVDILPTGSAPETRSVRGANLCRISIQQ
AAQSDVWVVLSVIDNLVKGAAGQAVQNMNIMFGLEETHGLDAIPLLP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaaatcaaagtcggcattgtcggcgcgacgggctacaccggcgtggaactg
ctgcgcctgcttgccgcccatcccgatgtcgaagtcgccgccgtaaccagccgcagcgaa
gcgggaaccgcagttgccgattactttccgagtttgcgcggcgtgtacggcctcgccttc
caaacgcccgacgaggcaggtttggaacaatgcgacatcgtcttcttcgccacgcccaac
ggcatcgccatgaaagacgcgccgcgcctgattgaacagggcgtgcgcgtcatcgacctt
tccgccgacttccgcatacgggacattccgacctgggaacactggtacggcatgacccac
gccgcccccgacctcgtttcccaagccgtgtacggattgagcgaactcaaccgcgaagcc
gtcgcacaggcgcgcctcgtcgccaaccccggctgctacccgacctgcgtatccctaccg
ctcgtgccgctgttgcggcaatgccgtctgaagcccggtatgccgctgattgccgactgc
aaatccggtgtgtccggcgcgggcaggaaaggcaatgtcggttcgctgttgtgcgaagcc
ggcgacaacttcaaagcctacggcatagccggacaccgccacctgcccgaaatcaggcag
accatcgccgggcttcaggacggcatcgccgaaggattcgtgttcacgccgcacctcgcg
ccaatgatacgcggtatgcacgccaccgtttacctccacctttcagacggcagcgacccc
gaaaccgtcctgcgcgactactaccgcgacagcccgttcgtggacatcctgccgaccggt
tccgcccccgaaacccgcagcgtgcgcggcgcaaacctctgccgcatcagcatccaacag
gcggcgcaatccgatgtgtgggtcgtcctttccgtcatcgacaacctcgtcaaaggcgcg
gcgggtcaggcagtccaaaatatgaacattatgttcggactggaggaaacacacggcttg
gacgcaatccccctgctcccctga

DBGET integrated database retrieval system