KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1794Help
Entry
NMB1794           CDS       T00027                                 

Definition
(RefSeq) citrate transporter
  KO
K03300  citrate-Mg2+:H+ or citrate-Ca2+:H+ symporter, CitMHS family
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nme00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    NMB1794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CitMHS Na_H_antiporter
Motif
Other DBs
NCBI-GeneID: 903305
NCBI-ProteinID: NP_274792
UniProt: Q7DD80
Position
complement(1882534..1883847)
Genome map
AA seq 437 aa AA seqDB search
MLTFIGLLIIGVIVWLLLTEKVSPIIALILVPLFGALLAGFDVSQLKEFYSGGTKSVMQI
VIMFMFSILFFGIMNDVGLFRPMIGGLIKLTRGNIVAVSVGTVLVSVVAQLDGAGATTFL
LVVPALLPLYKRLHMNPYLLFLLLTSSAGLINLLPWGGPTGRVASVLGADVGELYKPLLT
VQIIGVVFILALSLLLGVREKRRIVRELGALPAVADLIKPVPLSEEEQKLARPKLFWWNV
LLFLAAMSLLFSGIFPPGYVFMLAATAALLLNYRSPQEQMERIYAHAGGAVMMASIILAA
GTFLGILKGAGMLDAISKDIVHILPDALLPYLHIAIGVLGIPLELVLSTDAYYFGLFPIV
EQITSQAGVAPEAAGYAMLIGSIVGTFVTPLSPALWMGLGLAKLSMGKHIRYSFFWAWGL
SLAILASSIAAGIVPLP
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgtttatcggactgctgattatcggggtcatcgtatggctgctgctgacggaa
aaagtgtcgcccatcatcgcattaatcttggtgccgctgtttggggcgttgctggcgggg
tttgatgtatcccaattaaaagaattttattcgggcggcaccaaatcggtgatgcagatt
gtgattatgtttatgttttccattttgttttttggaatcatgaacgatgtggggctgttc
cgtccgatgataggcggtttgattaagctgactcggggtaatatcgtggcagtgagtgtg
gggacggtcttggtgtcggtggtggcgcagttggacggggcgggtgcgacgacgttttta
ttggtcgtccccgcccttttgccgctttacaagcgtctgcatatgaatccttacctgctg
tttttgctgctgacttccagtgcgggattgattaaccttctgccgtggggcgggccgacc
gggcgggttgcaagcgtgttgggcgcagatgtgggcgaattgtataaacctttgttgacg
gtgcaaattatcggtgtggtgtttatccttgcgctgtccctgcttttgggtgtgcgtgaa
aaaaggcggattgtccgggagttgggcgcgttgcccgccgtggcggatttgataaagccg
gtgcctttgtcggaagaagaacaaaaattggcgcgtccgaaactgttttggtggaatgtc
ctgctgtttttggcggcgatgagcctgcttttttcgggcatcttcccaccgggttatgta
tttatgctggctgcaacggcggcgttgcttttgaattaccgcagcccgcaggaacagatg
gagcggatttatgcccacgccggcggcgcggtgatgatggcgtccattattttggcggca
ggtacgtttttggggattttgaagggtgcggggatgttggacgcgatttccaaagacatt
gtgcatatcctgccggacgcgctgctgccttatctgcatattgccatcggtgtgttgggc
attccgcttgagttggttttgagtacggacgcttattatttcggactgtttccgattgtg
gagcagattacctcgcaggcgggcgtggcgcccgaagcagcaggttatgcgatgttgatc
ggcagtatcgtcggcacttttgttacgccgctttcgccggctttgtggatgggcttgggt
ttggcgaaattgtcgatgggcaaacacatccgttattcgtttttctgggcgtggggtttg
tcgctggcgatattggccagttcgatagcggcaggaatcgtgcctctgccgtaa

DBGET integrated database retrieval system