KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1813Help
Entry
NMB1813           CDS       T00027                                 

Gene name
aroK
Definition
(RefSeq) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
nme01230  Biosynthesis of amino acids
Module
nme_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMB1813 (aroK)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     NMB1813 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 dNK AAA_17 TsaE AAA AAA_22 PduV-EutP Cytidylate_kin AAA_5
Motif
Other DBs
NCBI-GeneID: 903287
NCBI-ProteinID: NP_274810
UniProt: P63600
Position
1904854..1905366
Genome map
AA seq 170 aa AA seqDB search
MKNFNGKLILIGLMGAGKTTLGRQMAQRLDYRFYDSDHEIAAAAGVPIPTIFEMEGEQGF
RSRETAILKKLVILPHIVLSTGGGAVLKEENRALIRKSGTVVYLHAPPETLLERTRCDNS
RPLLQVADPLAKLRELYAARDPVYRQTADFTVESANCRETVQTLLKRLSR
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactttaacggcaaactcatcctcatcggactgatgggcgcgggcaaaaccacg
ctgggccggcaaatggcgcagcggctggattaccgtttttacgacagcgatcacgaaatc
gccgcagccgccggcgttcccatccccaccatatttgaaatggaaggcgaacagggattc
cgttcgcgcgaaaccgccatactcaaaaagctggttatcctgccccatatcgtcctgtcc
accggcggcggcgcggtgttaaaagaagaaaaccgcgcccttatccgcaaaagcggcacg
gtcgtctatctgcacgccccgcccgaaaccctgctcgaacgcacgcgctgcgacaacagc
cgtcctttgctgcaagttgccgatcctttggcgaaattacgtgaactctacgccgcacgc
gaccccgtttaccgccaaaccgccgactttaccgtagaatcggcaaactgccgggaaacc
gtgcaaaccctgctcaaacgcttatcccgataa

DBGET integrated database retrieval system