KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1830Help
Entry
NMB1830           CDS       T00027                                 

Definition
(RefSeq) phosphoglycolate phosphatase
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00630  Glyoxylate and dicarboxylate metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NMB1830
Enzymes [BR:nme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     NMB1830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Acid_PPase S6PP
Motif
Other DBs
NCBI-GeneID: 903270
NCBI-ProteinID: NP_274827
UniProt: Q9JXY9
Position
1927037..1927696
Genome map
AA seq 219 aa AA seqDB search
MTTPKLIIFDWDGTLADTTQPIIDTMRRSFAECGFPPPEAERVRSLIGYSLPEIIRTLLE
MPSETAVADITRTYSAHYLNPNNRNMSLFPDALPCLDKLKAQGYWLAVATGKGRAGLDNA
ISQTATGGYWLATACAGEYPSKPSPEMVFGICGELGLDPKEALVVGDTAHDLHMAANAGA
AAVGVATGAHSREQLLSAPHLAVLDGLSELPGFLAQHYA
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcccaaactcatcatcttcgactgggacggcacgcttgccgatacgacccaa
cccatcatcgacaccatgcgccgcagcttcgccgaatgcggttttccgccgcccgaagcg
gaacgcgtccgcagcctgattggctacagcctgcccgaaatcatccgcaccctgctcgaa
atgccgtctgaaaccgccgttgccgacatcacacgcacttattccgcacattacctcaat
cccaacaaccgcaatatgtccttatttcccgatgccctgccctgtctggacaagctcaaa
gcacaaggatactggcttgccgtcgccacgggcaaagggcgggcgggtttggacaacgcc
atcagtcaaaccgccaccggcggctattggctcgccaccgcctgcgcgggggaatatccc
tccaaaccctcgcccgaaatggtattcggaatctgcggcgaactgggactcgacccgaaa
gaggcattggtcgtcggcgatacggcgcacgacctgcatatggcggcaaacgcaggcgcg
gcggcagtcggcgtggccaccggcgcacattcgcgcgaacagctccttagcgcaccgcat
ctcgccgtattggacggtttgtccgaactgcccggttttcttgcacaacattacgcctga

DBGET integrated database retrieval system