KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1834Help
Entry
NMB1834           CDS       T00027                                 

Gene name
ribF
Definition
(RefSeq) bifunctional riboflavin kinase/FMN adenylyltransferase
  KO
K11753  riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00740  Riboflavin metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    NMB1834 (ribF)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     NMB1834 (ribF)
   2.7.7  Nucleotidyltransferases
    2.7.7.2  FAD synthetase
     NMB1834 (ribF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_syn Flavokinase CTP_transf_like NRIP1_repr_3
Motif
Other DBs
NCBI-GeneID: 903266
NCBI-ProteinID: NP_274831
UniProt: Q9JXY6
Position
complement(1933515..1934435)
Genome map
AA seq 306 aa AA seqDB search
MRIRLGRHNAPDFPQGAAVTIGNFDGVHLGHKHILQKLRLEADARGLPVVTVVFEPQPKE
FFALRTGRMPPCRISPLRTKLELLEGTGCVDAVWVLRFDQNFSEISAQGFIDRLLRQTLN
TRYLLVGDDFRFGAGREGCFELLAQQPDMQTERTPSVIVEDIRTSSTAVRQALSDGNLAY
AKKLLGHDYVLSGRVVHGRKLGRTLNAPTANIRLPRHRYALGGVFVVEADGAFGTRRGVA
SFGFNPTVDSGCSQKLEVHLFDFQGDLYGQGLNVRFLHKLRDEEKFDGMEELKRQIEADM
EAARRW
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcaggctggggcggcacaacgcgcccgactttccacagggtgccgccgtaacc
ataggcaatttcgacggcgtacacctcggacacaaacacatcctccaaaaactccgcctc
gaagccgacgcgcgcggactgcccgtcgtgaccgtcgttttcgaaccccaacccaaagaa
tttttcgcactccgcaccggcaggatgccaccgtgtcggatcagccccctgcgcaccaag
ctcgaattattggaaggcacaggctgtgtcgatgccgtctgggttttgcgtttcgatcaa
aatttttccgaaatatccgcgcaagggtttatcgaccgcctgctgcgtcaaaccttgaat
acgcgttatttgctcgtcggcgatgatttccgtttcggtgcggggcgggaaggctgtttt
gaacttttggcacaacagcccgatatgcagaccgagcgtacgccttccgtcatcgtcgaa
gacatccgcaccagcagtaccgccgtgcgacaagccctttcagacggcaaccttgcctat
gcgaaaaaacttttgggacacgactacgtcttgagcggcagggtggtgcacggcagaaaa
ctcggacgcaccttaaacgccccgactgccaacatccgcctgccccgccaccgttatgca
ctcggcggcgtgtttgtcgtcgaagcagacggcgcattcggcacgcggcgcggcgtggcg
agtttcggcttcaatcccaccgttgatagcggctgttctcaaaagcttgaagtccacctg
ttcgactttcaaggcgacctgtacggacaagggctgaacgtccgcttcctgcacaaactg
cgcgatgaggaaaagtttgacggtatggaagaactgaaaaggcagattgaagccgatatg
gaagccgcaaggcgttggtag

DBGET integrated database retrieval system