KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1841Help
Entry
NMB1841           CDS       T00027                                 

Definition
(RefSeq) mannose-1-phosphate guanylyltransferase
  KO
K00992  N-acetyl-alpha-D-muramate 1-phosphate uridylyltransferase [EC:2.7.7.99]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00520  Amino sugar and nucleotide sugar metabolism
nme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NMB1841
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.99  N-acetyl-alpha-D-muramate 1-phosphate uridylyltransferase
     NMB1841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-GeneID: 903258
NCBI-ProteinID: NP_274838
UniProt: Q9JXY0
Position
complement(1942087..1942782)
Genome map
AA seq 231 aa AA seqDB search
MKAMILAAGRGERMRPLTDTTPKPLLDVAGKPLIGWHLCRLKQAGFTEIVINHAWLGRQI
EDALGDGSAYGVNIAYSPEPAGGLETAGGIAQALPLLGGQPFLVVNGDVLTDIDFTAAFQ
TASSLPEHISAHLWLVENPPHNPDGDFSLLPDSSVRPEVNGGNGLTFSGVGIYRPEMFDG
IEAGSVAKLAPVLRGEMRQNRVSGQKHTGLWLDVGTVCRLKEAQALAGAWK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgatgatactggcggcaggacgcggcgagcgtatgcgccctttgaccgatacc
actccgaagccgctgctcgatgtggcgggtaagcctctaatcggttggcacctatgccgt
ctgaagcaggcggggtttaccgaaatcgtcatcaaccacgcttggctgggtcggcagata
gaagatgctttgggcgacggctcggcttatggcgtgaacatcgcctattcgcccgaaccc
gcaggcggtttggaaacggcaggcggcatcgcgcaggcattgccgctgttgggtgggcag
ccgtttttggtggtcaacggcgacgtgctgaccgacatcgattttaccgccgcgtttcag
acggcatcgtccctgccggaacatatttccgcccatctgtggctggtggaaaatccgccg
cacaaccccgacggcgatttttccctgctgcccgacagcagcgtgcggccggaagtaaat
ggcggcaacggattgacattcagcggcgtgggtatttaccgtcctgaaatgtttgacgga
atcgaagcgggcagtgtggcgaaactcgcgcccgtattgcgtggcgaaatgcggcaaaac
cgcgtgagcggtcagaagcatacgggcttgtggctggatgtcggcacggtatgccgtctg
aaagaggctcaagcccttgcaggggcttggaagtaa

DBGET integrated database retrieval system